Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-11, Human (His)

IL-11 protein is a cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, leading to increased platelet production. Animal-Free IL-11 Protein, Human (His) is the recombinant human-derived animal-FreeIL-11 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-11 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-11-protein-human-his.html

Purity

95.0

Smiles

PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Molecular Formula

3589 (Gene_ID) P20809 (P22-L199) (Accession)

Molecular Weight

Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H-Met-D-Met-OH
4003884.0005 5 g

H-Met-D-Met-OH

Sign In for Pricing
View Details
Recombinant Enterobacteria phage T4 Tail sheath-stabilizing protein Gp3 (3)
MBS1021673-01 0.02 mg (E-Coli)

Recombinant Enterobacteria phage T4 Tail sheath-stabilizing protein Gp3 (3)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage T4 Tail sheath-stabilizing protein Gp3 (3)
MBS1021673-02 0.1 mg (E-Coli)

Recombinant Enterobacteria phage T4 Tail sheath-stabilizing protein Gp3 (3)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage T4 Tail sheath-stabilizing protein Gp3 (3)
MBS1021673-03 0.02 mg (Yeast)

Recombinant Enterobacteria phage T4 Tail sheath-stabilizing protein Gp3 (3)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage T4 Tail sheath-stabilizing protein Gp3 (3)
MBS1021673-04 0.1 mg (Yeast)

Recombinant Enterobacteria phage T4 Tail sheath-stabilizing protein Gp3 (3)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage T4 Tail sheath-stabilizing protein Gp3 (3)
MBS1021673-05 0.02 mg (Baculovirus)

Recombinant Enterobacteria phage T4 Tail sheath-stabilizing protein Gp3 (3)

Sign In for Pricing
View Details