Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone deacetylase 1/HDAC1, Human (His-SUMO)

Studies have confirmed that the histone deacetylase 1 (HDAC1) protein is a key enzyme that deacetylates lysine residues on core histones (H2A, H2B, H3, H4) . This process establishes an epigenetic repressive signature that affects transcription, cell cycle, and developmental events. Histone deacetylase 1/HDAC1 Protein, Human (His-SUMO) is the recombinant human-derived Histone deacetylase 1/HDAC1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

Histone deacetylase 1/HDAC1 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/histone-deacetylase-1-hdac1-human-his-sumo.html

Purity

97.00

Smiles

MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA

Molecular Formula

3065 (Gene_ID) Q13547 (M1-A482) (Accession)

Molecular Weight

71-74 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Triggering Receptor Expressed On Myeloid Cells 2 (TREM2) ELISA Kit
DLR-TREM2-Hu-96T 96 Tests

Human Triggering Receptor Expressed On Myeloid Cells 2 (TREM2) ELISA Kit

Sign In for Pricing
View Details
Ostalpha sgRNA CRISPR Lentivector (Rat) (Target 2)
K6345603 1.0 µg DNA

Ostalpha sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal NMT2 Antibody [DyLight 350]
NBP2-32244UV 0.1 mL

Rabbit Polyclonal NMT2 Antibody [DyLight 350]

Sign In for Pricing
View Details
HIV-1 p24 Antibody [8D7E11]
MBS154922-01 0.1 mg

HIV-1 p24 Antibody [8D7E11]

Sign In for Pricing
View Details
HIV-1 p24 Antibody [8D7E11]
MBS154922-02 5x 0.1 mg

HIV-1 p24 Antibody [8D7E11]

Sign In for Pricing
View Details
RPL31P41 CRISPR Knock Out 293T Cell Line (Human)
41383141 1x 10^6 Cells / 1.0 mL

RPL31P41 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details