What is the catalog number for EGF, Mouse?

The catalog number for EGF, Mouse is HY-P7067.

What sizes are available for EGF, Mouse?

EGF, Mouse is available in the following size(s): 2 µg, 5 µg, 10 µg, 20 µg, 50 µg, 100 µg.

How many pack sizes does EGF, Mouse come in?

EGF, Mouse is available in 6 different pack sizes.

Is EGF, Mouse in stock?

EGF, Mouse is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures EGF, Mouse?

EGF, Mouse is manufactured by QuantiMol.

What is the estimated delivery time for EGF, Mouse?

Estimated delivery time for EGF, Mouse is approximately 15 business day(s), depending on your location.

EGF, Mouse

EGF Protein, Mouse is a growth factor that stimulates the proliferation of the epidermis and several epithelial tissues.

Product Specifications

Product Name Alternative

EGF Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Related Pathways

Others

Assay Protocol

https://www.medchemexpress.com/cytokines/egf-protein-mouse.html

Purity

98.0

Smiles

NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Molecular Formula

13645 (Gene_ID) P01132 (N977-R1029) (Accession)

Molecular Weight

Approximately 6-7 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Hynes NE, et al. ERBB receptors and cancer: the complexity of targeted inhibitors. Nat Rev Cancer. 2005 May;5 (5) :341-54.|[2]Salomon DS, et al. Epidermal growth factor-related peptides and their receptors in human malignancies. Crit Rev Oncol Hematol. 1995 Jul;19 (3) :183-232.