Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein E/APOE, Mouse (HEK293, His)

Apolipoprotein E/APOE is a key molecule linking lipid metabolism and neurological function. Apolipoprotein E/APOE gene polymorphisms are closely associated with diseases such as Alzheimer’s disease and atherosclerosis by influencing protein structure and function. Apolipoprotein E/APOE Protein, Mouse (HEK293, His) is a recombinant APOE protein expressed in HEK293 cells, with a C-6*His tag[1][2][3].

Product Specifications

Product Name Alternative

Apolipoprotein E/APOE Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-e-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQHHHHHH

Molecular Formula

11816 (Gene_ID) P08226 (E19-Q311) (Accession)

Molecular Weight

Approximately 34-40 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Gong JS, et al. Novel action of apolipoprotein E (ApoE) : ApoE isoform specifically inhibits lipid-particle-mediated cholesterol release from neurons. Mol Neurodegener. 2007 May 15;2:9.|[2]Hatters DM, et al. Apolipoprotein E structure: insights into function. Trends Biochem Sci. 2006 Aug;31 (8) :445-54.|[3]Eichner JE, et al. Apolipoprotein E polymorphism and cardiovascular disease: a HuGE review. Am J Epidemiol. 2002 Mar 15;155 (6) :487-95.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRTM2 (NM_015564) Human Recombinant Protein
TP720484 10 µg

LRRTM2 (NM_015564) Human Recombinant Protein

Sign In for Pricing
View Details
Pan-Lactyl-lysine Recombinant Rabbit Monoclonal Antibody [PSH03-73]
HA722037 100 µL

Pan-Lactyl-lysine Recombinant Rabbit Monoclonal Antibody [PSH03-73]

Sign In for Pricing
View Details
FITC Conjugated Goat Polyclonal Antibody to Human Prealbumin
FA-2112-2 2 mL

FITC Conjugated Goat Polyclonal Antibody to Human Prealbumin

Sign In for Pricing
View Details
Hydroxy-Bexagliflozin (Mixture of Diastereomers)
TRC-H965650-10MG 10 mg

Hydroxy-Bexagliflozin (Mixture of Diastereomers)

Sign In for Pricing
View Details
Human Pallidin (BLOC1S6) activation kit by CRISPRa
GA108823 1 Kit

Human Pallidin (BLOC1S6) activation kit by CRISPRa

Sign In for Pricing
View Details
VEGF (Vascular Endothelial Growth Factor) (VG76e), CF488A conjugate, 0.1mg/mL
BNC881687-100 1x 100 µL

VEGF (Vascular Endothelial Growth Factor) (VG76e), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details