Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein E/APOE, Mouse (HEK293, His)

Apolipoprotein E/APOE is a key molecule linking lipid metabolism and neurological function. Apolipoprotein E/APOE gene polymorphisms are closely associated with diseases such as Alzheimer’s disease and atherosclerosis by influencing protein structure and function. Apolipoprotein E/APOE Protein, Mouse (HEK293, His) is a recombinant APOE protein expressed in HEK293 cells, with a C-6*His tag[1][2][3].

Product Specifications

Product Name Alternative

Apolipoprotein E/APOE Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-e-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQHHHHHH

Molecular Formula

11816 (Gene_ID) P08226 (E19-Q311) (Accession)

Molecular Weight

Approximately 34-40 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Gong JS, et al. Novel action of apolipoprotein E (ApoE) : ApoE isoform specifically inhibits lipid-particle-mediated cholesterol release from neurons. Mol Neurodegener. 2007 May 15;2:9.|[2]Hatters DM, et al. Apolipoprotein E structure: insights into function. Trends Biochem Sci. 2006 Aug;31 (8) :445-54.|[3]Eichner JE, et al. Apolipoprotein E polymorphism and cardiovascular disease: a HuGE review. Am J Epidemiol. 2002 Mar 15;155 (6) :487-95.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Renalase (Renal Cell Marker) (RNLS/1940), CF594 conjugate, 0.1mg/mL
BNC941940-500 1x 500 µL

Renalase (Renal Cell Marker) (RNLS/1940), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ankyrin brain (ANK2) Mouse Monoclonal Antibody [Clone ID: N105/13]
75-144 100 µL

Ankyrin brain (ANK2) Mouse Monoclonal Antibody [Clone ID: N105/13]

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Goat Polyclonal Antibody to Human Lambda (Free Bence Jones),
AA-2109-1 1 mL

Alkaline Phosphatase Conjugated Goat Polyclonal Antibody to Human Lambda (Free Bence Jones),

Sign In for Pricing
View Details
P53 (Tumor Suppressor Protein) (TP53/2719), CF568 conjugate, 0.1mg/mL
BNC682719-500 1x 500 µL

P53 (Tumor Suppressor Protein) (TP53/2719), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human AKR1B15 activation kit by CRISPRa
GA118500 1 Kit

Human AKR1B15 activation kit by CRISPRa

Sign In for Pricing
View Details
DHLAG (CD74) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G10]
TA507336BM 100 µL

DHLAG (CD74) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G10]

Sign In for Pricing
View Details