Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein E/APOE, Mouse (HEK293, His)

Apolipoprotein E/APOE is a key molecule linking lipid metabolism and neurological function. Apolipoprotein E/APOE gene polymorphisms are closely associated with diseases such as Alzheimer’s disease and atherosclerosis by influencing protein structure and function. Apolipoprotein E/APOE Protein, Mouse (HEK293, His) is a recombinant APOE protein expressed in HEK293 cells, with a C-6*His tag[1][2][3].

Product Specifications

Product Name Alternative

Apolipoprotein E/APOE Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-e-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQHHHHHH

Molecular Formula

11816 (Gene_ID) P08226 (E19-Q311) (Accession)

Molecular Weight

Approximately 34-40 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Gong JS, et al. Novel action of apolipoprotein E (ApoE) : ApoE isoform specifically inhibits lipid-particle-mediated cholesterol release from neurons. Mol Neurodegener. 2007 May 15;2:9.|[2]Hatters DM, et al. Apolipoprotein E structure: insights into function. Trends Biochem Sci. 2006 Aug;31 (8) :445-54.|[3]Eichner JE, et al. Apolipoprotein E polymorphism and cardiovascular disease: a HuGE review. Am J Epidemiol. 2002 Mar 15;155 (6) :487-95.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOK (MAPK/MAK/MRK Overlapping Kinase, MOK Protein Kinase, Renal Tumor Antigen 1, RAGE1 RAGE-1, RAGE) (PE)
129792-PE 100 µL

MOK (MAPK/MAK/MRK Overlapping Kinase, MOK Protein Kinase, Renal Tumor Antigen 1, RAGE1 RAGE-1, RAGE) (PE)

Sign In for Pricing
View Details
RPS6KB1 Recombinant Antibody, Cy3 Conjugated
bsm-62971R-Cy3-01 20 µL

RPS6KB1 Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
RPS6KB1 Recombinant Antibody, Cy3 Conjugated
bsm-62971R-Cy3-02 100 µL

RPS6KB1 Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Mmu-miR-34a-3p agomir
HY-R03076A-01 5 nmol

Mmu-miR-34a-3p agomir

Sign In for Pricing
View Details
Mmu-miR-34a-3p agomir
HY-R03076A-02 20 nmol

Mmu-miR-34a-3p agomir

Sign In for Pricing
View Details
Recombinant Family With Sequence Similarity 3, Member B (FAM3B)
TRV-0013969-01 10 µg

Recombinant Family With Sequence Similarity 3, Member B (FAM3B)

Sign In for Pricing
View Details