Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calnexin, Mouse (HEK293, His)

Calnexin interacts with monoglucosylated glycoproteins, helping their assembly and retention in the endoplasmic reticulum (ER) . Calnexin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Calnexin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Calnexin Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calnexin-protein-mouse-hek293-his.html

Purity

96.0

Smiles

HDGHDDDAIDIEDDLDDVIEEVEDSKSKSDASTPPSPKVTYKAPVPTGEVYFADSFDRGSLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTAELSLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIADPDAVKPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPFSAIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEPGVVLQMLEAAEERP

Molecular Formula

12330 (Gene_ID) P35564 (H21-P482) (Accession)

Molecular Weight

Approximately 58-70 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AZGP1 Antibody (N-term)
E45G02149G-1 100 µL

AZGP1 Antibody (N-term)

Sign In for Pricing
View Details
ABCC13 (B-2)
sc-390691 200 µg/mL

ABCC13 (B-2)

Sign In for Pricing
View Details
Anti-Human GFRAL Antibody (25M22), PE
HS720127-01 1 Each

Anti-Human GFRAL Antibody (25M22), PE

Sign In for Pricing
View Details
Anti-Human GFRAL Antibody (25M22), PE
HS720127-02 100 Tests

Anti-Human GFRAL Antibody (25M22), PE

Sign In for Pricing
View Details
KLHL8 antibody
70R-8348 50 ug

KLHL8 antibody

Sign In for Pricing
View Details
GLT8D2 Blocking Peptide
33R-4131 0.1 mg

GLT8D2 Blocking Peptide

Sign In for Pricing
View Details