Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH, Human

PTH Protein, Human is a major regulator of mineral ion metabolism.

Product Specifications

Product Name Alternative

PTH Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pth-protein-human.html

Purity

98

Smiles

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

Molecular Formula

5741 (Gene_ID) P01270 (S32-Q115) (Accession)

Molecular Weight

Approximately 9-15 kDa

References & Citations

[1]Kim ES, et al. Recombinant Human Parathyroid Hormone (1-84) : A Review in Hypoparathyroidism. Drugs. 2015 Jul;75 (11) :1293-303.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pdgfrb ORF Vector (Mouse) (pORF)
ORF053683 1.0 µg DNA

Pdgfrb ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Human DR1 Protein
ARP1919-01 10 µg

Recombinant Human DR1 Protein

Sign In for Pricing
View Details
Recombinant Human DR1 Protein
ARP1919-02 50 µg

Recombinant Human DR1 Protein

Sign In for Pricing
View Details
Recombinant Human DR1 Protein
ARP1919-03 100 µg

Recombinant Human DR1 Protein

Sign In for Pricing
View Details
Recombinant Human DR1 Protein
ARP1919-04 1 mg

Recombinant Human DR1 Protein

Sign In for Pricing
View Details
HTATSF1, CT (HIV Tat-specific factor 1, HIV-1 Tat specific factor 1) (Biotin) discontinued
036819-Biotin 200 µL

HTATSF1, CT (HIV Tat-specific factor 1, HIV-1 Tat specific factor 1) (Biotin) discontinued

Sign In for Pricing
View Details