Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus DNA-binding protein HU (hup)

Product Specifications

Abbreviation

Recombinant Staphylococcus aureus hup protein

Gene Name

Hup

UniProt

Q5HFV0

Expression Region

1-90aa

Organism

Staphylococcus aureus (strain COL)

Target Sequence

MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKGRNPQTGKEIDIPASKVPAFKAGKALKDAVK

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Curlin is the structural subunit of the curli fimbriae. Curli are coiled surface structures that assemble preferentially at growth temperatures below 37 degrees Celsius. Curli can bind to fibronectin. The minor subunit is the nucleation component of curlin monomers. Coexpression of cellulose and thin aggregative fimbriae (curli fimbrae or fibers) leads to a hydrophobic network with tightly packed cells embedded in a highly inert matrix that confers cohesion, elasticity and tissue-like properties to colonies

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.5 kDa

References & Citations

"Cellulose as an architectural element in spatially structured Escherichia coli biofilms." Serra D.O., Richter A.M., Hengge R. J. Bacteriol. 195:5540-5554 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N, N-Diethyl-p-phenylenediamine Sulfate
HY-W009425-01 100 g

N, N-Diethyl-p-phenylenediamine Sulfate

Sign In for Pricing
View Details
N, N-Diethyl-p-phenylenediamine Sulfate
HY-W009425-02 10 mM - 1 mL

N, N-Diethyl-p-phenylenediamine Sulfate

Sign In for Pricing
View Details
Goat anti-Human Kappa (?) Light Chain - Affinity Pure, Biotin Conjugate
MBS687360-01 0.5 mg

Goat anti-Human Kappa (?) Light Chain - Affinity Pure, Biotin Conjugate

Sign In for Pricing
View Details
Goat anti-Human Kappa (?) Light Chain - Affinity Pure, Biotin Conjugate
MBS687360-02 5x 0.5 mg

Goat anti-Human Kappa (?) Light Chain - Affinity Pure, Biotin Conjugate

Sign In for Pricing
View Details
TNP1 Antibody, HRP conjugated
A37186-50UG 50 µg

TNP1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit Anti-Human TCP11L2 pAb
PA6863-01 50 μL

Rabbit Anti-Human TCP11L2 pAb

Sign In for Pricing
View Details