Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus DNA-binding protein HU (hup)

Product Specifications

Abbreviation

Recombinant Staphylococcus aureus hup protein

Gene Name

Hup

UniProt

Q5HFV0

Expression Region

1-90aa

Organism

Staphylococcus aureus (strain COL)

Target Sequence

MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKGRNPQTGKEIDIPASKVPAFKAGKALKDAVK

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Curlin is the structural subunit of the curli fimbriae. Curli are coiled surface structures that assemble preferentially at growth temperatures below 37 degrees Celsius. Curli can bind to fibronectin. The minor subunit is the nucleation component of curlin monomers. Coexpression of cellulose and thin aggregative fimbriae (curli fimbrae or fibers) leads to a hydrophobic network with tightly packed cells embedded in a highly inert matrix that confers cohesion, elasticity and tissue-like properties to colonies

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.5 kDa

References & Citations

"Cellulose as an architectural element in spatially structured Escherichia coli biofilms." Serra D.O., Richter A.M., Hengge R. J. Bacteriol. 195:5540-5554 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal S1P4/EDG-6 Antibody (1)
NBP2-66579 100 µg

Mouse Monoclonal S1P4/EDG-6 Antibody (1)

Sign In for Pricing
View Details
Ssxb1 Protein Vector (Mouse) (pPM-C-His)
PV234281 500 ng

Ssxb1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
LOC685406 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6007905 3x 1.0 µg

LOC685406 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
CD56 Recombinant Monoclonal Mouse Antibody (r5.1H11), PerCP Conjugate - Biotium Choice
P026-PCP-125 1x 125 µL

CD56 Recombinant Monoclonal Mouse Antibody (r5.1H11), PerCP Conjugate - Biotium Choice

Sign In for Pricing
View Details
EIF1B Protein Vector (Mouse) (pPM-C-HA)
19072024 500 ng

EIF1B Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Boc (NM_172506) Mouse Tagged ORF Clone Lentiviral Particle
MR211647L3V 200 µL

Boc (NM_172506) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details