Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3 epsilon, Rat (HEK293, Fc)

CD3 epsilon Protein, a vital component of the TCR-CD3 complex on T-lymphocytes, is pivotal for adaptive immune responses. CD3E is crucial for proper T-cell development and contributes to TCR-CD3 complex internalization and down-regulation[1]. CD3 epsilon Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD3 epsilon protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD3 epsilon Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3-epsilon-protein-rat-hek293-fc.html

Purity

95.0

Smiles

YEVSISGTSVELTCPLENEDNLKWEKNDKVLPDKNEKHLVLEDFSEVKDSGYYVCYTESSRKNTYLYLKARVCENCMEVD

Molecular Formula

315609 (Gene_ID) NP_001101610.1 (Y24-D103) (Accession)

Molecular Weight

Approximately 36.1 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF647 conjugate, 0.1mg/mL
BNC470333-500 1x 500 µL

CD8 (RIV11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
BNC470177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF488A conjugate, 0.1mg/mL
BNC881045-500 1x 500 µL

CD16 (C16/1045), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL
BNC400178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoD1 (MYD712), CF647 conjugate, 0.1mg/mL
BNC470712-100 1x 100 µL

MyoD1 (MYD712), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details