Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3 epsilon, Rat (HEK293, Fc)

CD3 epsilon Protein, a vital component of the TCR-CD3 complex on T-lymphocytes, is pivotal for adaptive immune responses. CD3E is crucial for proper T-cell development and contributes to TCR-CD3 complex internalization and down-regulation[1]. CD3 epsilon Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD3 epsilon protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD3 epsilon Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3-epsilon-protein-rat-hek293-fc.html

Purity

95.0

Smiles

YEVSISGTSVELTCPLENEDNLKWEKNDKVLPDKNEKHLVLEDFSEVKDSGYYVCYTESSRKNTYLYLKARVCENCMEVD

Molecular Formula

315609 (Gene_ID) NP_001101610.1 (Y24-D103) (Accession)

Molecular Weight

Approximately 36.1 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPAS1 Antibody (Biotin)
orb401083-01 50 µg

EPAS1 Antibody (Biotin)

Sign In for Pricing
View Details
EPAS1 Antibody (Biotin)
orb401083-02 100 µg

EPAS1 Antibody (Biotin)

Sign In for Pricing
View Details
Mouse Monoclonal ATRIP Antibody (OTI5E7) [mFluor Violet 500 SE]
NBP2-72271MFV500 0.1 mL

Mouse Monoclonal ATRIP Antibody (OTI5E7) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Human SYNC Pre-designed siRNA Set B
SI016110B 1 Each

Human SYNC Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant Xanthomonas campestris pv. campestris Glucokinase (glk)
MBS1461682-01 0.02 mg (E-Coli)

Recombinant Xanthomonas campestris pv. campestris Glucokinase (glk)

Sign In for Pricing
View Details
Recombinant Xanthomonas campestris pv. campestris Glucokinase (glk)
MBS1461682-02 0.02 mg (Yeast)

Recombinant Xanthomonas campestris pv. campestris Glucokinase (glk)

Sign In for Pricing
View Details