Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KGF-2/FGF-10, Human (N-His)

KGF-2/FGF-10 proteins coordinate embryonic development, regulate cell proliferation and differentiation, and are indispensable in branching morphogenesis. This multifunctional protein may aid in wound healing. KGF-2/FGF-10 Protein, Human (N-His) is the recombinant human-derived KGF-2/FGF-10 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

KGF-2/FGF-10 Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kgf-2-fgf-10-protein-human-n-his.html

Purity

95.00

Smiles

LGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

Molecular Formula

2255 (Gene_ID) O15520 (L40-S208) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDH7 Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI1G8]
TA700291 50 µg

PCDH7 Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI1G8]

Sign In for Pricing
View Details
Rabbit Polyclonal AFAP1L2 Antibody [DyLight 405]
NBP1-77358V 0.1 mL

Rabbit Polyclonal AFAP1L2 Antibody [DyLight 405]

Sign In for Pricing
View Details
RNF14 (NM_004290) Human Recombinant Protein
TP323304L 1 mg

RNF14 (NM_004290) Human Recombinant Protein

Sign In for Pricing
View Details
Myosin XVIIIa Double Nickase Plasmid (h2)
sc-403216-NIC-2 20 µg

Myosin XVIIIa Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Boc-Val-OMe
5-06203 5 g

Boc-Val-OMe

Sign In for Pricing
View Details
ELK4 Protein Vector (Rat) (pPB-N-His)
PV265983 500 ng

ELK4 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details