Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macrovipera lebetina obtusa Disintegrin obtustatin

Product Specifications

Abbreviation

Recombinant Macrovipera lebetina obtusa Disintegrin obtustatin protein

UniProt

P83469

Expression Region

1-41aa

Organism

Macrovipera lebetina obtusa (Levant blunt-nosed viper) (Vipera lebetina obtusa)

Target Sequence

CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG

Tag

C-terminal 6xHis-Myc-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Is a potent and selective inhibitor of alpha-1/beta-1 (ITGA1/ITGB1) integrin. It blocks the adhesion of alpha-1/beta-1-expressing K562 cells to immobilized collagens IV and I with IC (50) of 2 and 0.5 nM, respectively. Potently inhibits angiogenesis in chicken and in mouse model and reduces tumor development by half. Is 25-fold less potent than viperistatin.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

8.1 kDa

References & Citations

"Obtustatin: a potent selective inhibitor of alpha1beta1 integrin in vitro and angiogenesis in vivo." Marcinkiewicz C., Weinreb P.H., Calvete J.J., Kisiel D.G., Mousa S.A., Tuszynski G.P., Lobb R.R. Cancer Res. 63:2020-2023 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PMVK/phosphomevalonate kinase Antibody (21C10) [mFluor Violet 450 SE]
NBP2-59412MFV450 0.1 mL

Mouse Monoclonal PMVK/phosphomevalonate kinase Antibody (21C10) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
CORO6 Protein Vector (Mouse) (pPM-C-HA)
PV167444 500 ng

CORO6 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-Mouse IL-12 p75 Antibody (R2-9A5)
HY-P990224 1 Each

Anti-Mouse IL-12 p75 Antibody (R2-9A5)

Sign In for Pricing
View Details
Duck GDP Dissociation Inhibitor 2 (GDI2) ELISA Kit
MBS9925819 Inquire

Duck GDP Dissociation Inhibitor 2 (GDI2) ELISA Kit

Sign In for Pricing
View Details
GABRE (Gamma-aminobutyric Acid Receptor Subunit epsilon, Gamma-Aminobutyric Acid (GABA) A Receptor, epsilon)
481511 100 µL

GABRE (Gamma-aminobutyric Acid Receptor Subunit epsilon, Gamma-Aminobutyric Acid (GABA) A Receptor, epsilon)

Sign In for Pricing
View Details
Traf5 siRNA Oligos set (Mouse)
47437174 3x 5 nmol

Traf5 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details