Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Collectrin/TMEM27, Mouse (Myc, His-SUMO)

The Collectrin protein plays a crucial role in amino acid transport by binding to SLC6A18 and SLC6A19 and regulating their surface transport and activity. Furthermore, it may affect the trafficking of SLC3A1 and SLC7A9 to the renal cortical cell membrane. Collectrin/TMEM27 Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Collectrin protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Collectrin/TMEM27 Protein, Mouse (Myc, His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/collectrin-protein-mouse-myc-his-sumo.html

Smiles

ELCHPDAENAFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKVPNREATEISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIRKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVP

Molecular Formula

57394 (Gene_ID) Q9ESG4 (E15-P141) (Accession)

Molecular Weight

Approximately 34.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Inhibin Beta E (INHbE)
RPU53480-01 50 µg

Recombinant Mouse Inhibin Beta E (INHbE)

Sign In for Pricing
View Details
Recombinant Mouse Inhibin Beta E (INHbE)
RPU53480-02 100 µg

Recombinant Mouse Inhibin Beta E (INHbE)

Sign In for Pricing
View Details
Recombinant Mouse Inhibin Beta E (INHbE)
RPU53480-03 1 mg

Recombinant Mouse Inhibin Beta E (INHbE)

Sign In for Pricing
View Details
MFluor™ Violet 540 Anti-human CD45 Antibody *HI185*
10453120-AAT 100 Tests

MFluor™ Violet 540 Anti-human CD45 Antibody *HI185*

Sign In for Pricing
View Details
TRNAS22 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
48378111 3x 1.0 µg

TRNAS22 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
RPS26P29 CRISPR All-in-one AAV vector set (with saCas9)(Human)
42315151 3x 1.0 µg DNA

RPS26P29 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details