Collectrin/TMEM27, Mouse (Myc, His-SUMO)
The Collectrin protein plays a crucial role in amino acid transport by binding to SLC6A18 and SLC6A19 and regulating their surface transport and activity. Furthermore, it may affect the trafficking of SLC3A1 and SLC7A9 to the renal cortical cell membrane. Collectrin/TMEM27 Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Collectrin protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.
Product Specifications
Product Name Alternative
Collectrin/TMEM27 Protein, Mouse (Myc, His-SUMO), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/collectrin-protein-mouse-myc-his-sumo.html
Smiles
ELCHPDAENAFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKVPNREATEISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIRKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVP
Molecular Formula
57394 (Gene_ID) Q9ESG4 (E15-P141) (Accession)
Molecular Weight
Approximately 34.5 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Browse additional items from our catalog
Methyl 4-acetamido-5-chloro-2-methoxybenzoate (Standard)
Glyr1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)