Histone H3, Human
Histone H3 proteins are critical in nucleosomes, which compact DNA into chromatin and regulate DNA accessibility. Histone H3 Protein, Human is the recombinant human-derived Histone H3 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
Histone H3 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/histone-h3-protein-human.html
Purity
95.0
Smiles
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Molecular Formula
8350 (Gene_ID) P68431 (A2-A136) (Accession)
Molecular Weight
Approximately 15.3 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
APRab00715-01 20 µL
Phospho-SIRT1 (Ser47) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details APRab00715-02 50 µL
Phospho-SIRT1 (Ser47) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details APRab00715-03 100 µL
Phospho-SIRT1 (Ser47) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details APRab00715-04 200 µL
Phospho-SIRT1 (Ser47) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
MBS6396687-01 0.1 mL
TMOD2 (NTMOD, Tropomodulin-2, Neuronal Tropomodulin) (AP)
Sign In for Pricing
View Details