Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone H3, Human

Histone H3 proteins are critical in nucleosomes, which compact DNA into chromatin and regulate DNA accessibility. Histone H3 Protein, Human is the recombinant human-derived Histone H3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Histone H3 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/histone-h3-protein-human.html

Purity

95.0

Smiles

ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Molecular Formula

8350 (Gene_ID) P68431 (A2-A136) (Accession)

Molecular Weight

Approximately 15.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP44 Protein Vector (Mouse) (pPB-C-His)
PV244614 500 ng

USP44 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Anti-HCN4 Antibody (N489/89)
HY088023-01 50 µg

Anti-HCN4 Antibody (N489/89)

Sign In for Pricing
View Details
Anti-HCN4 Antibody (N489/89)
HY088023-02 100 µg

Anti-HCN4 Antibody (N489/89)

Sign In for Pricing
View Details
Anti-HCN4 Antibody (N489/89)
HY088023-03 1 mg

Anti-HCN4 Antibody (N489/89)

Sign In for Pricing
View Details
CHS5 Antibody
orb845141 2 mg

CHS5 Antibody

Sign In for Pricing
View Details
IL2 (Interleukin 2, IL-2, TCGF, lymphokine) (MaxLight 550)
MBS6217569-01 0.1 mL

IL2 (Interleukin 2, IL-2, TCGF, lymphokine) (MaxLight 550)

Sign In for Pricing
View Details