Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Atrial natriuretic peptide-converting enzyme (CORIN), partial

Product Specifications

Product Name Alternative

(Corin) (Heart-specific serine proteinase ATC2) (Pro-ANP-converting enzyme) (Transmembrane protease serine 10)

Abbreviation

Recombinant Human CORIN protein, partial

Gene Name

CORIN

UniProt

Q9Y5Q5

Expression Region

1-110aa

Organism

Homo sapiens (Human)

Target Sequence

MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVLLLVILLSYVGTLQKVYFKSNGSEPLVTDGEIQGSDVILTNTIYNQSTVVS

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Serine-type endopeptidase involved in atrial natriuretic peptide (NPPA) and brain natriuretic peptide (NPPB) processing . Converts through proteolytic cleavage the non-functional propeptides NPPA and NPPB into their active hormones, ANP and BNP (1-32) respectively, thereby regulating blood pressure in the heart and promoting natriuresis, diuresis and vasodilation . Proteolytic cleavage of pro-NPPA also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus . Also acts as a regulator of sodium reabsorption in kidney.; [Isoform 2]: has weaker endopeptidase activity compared to isoform 1.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.0 kDa

References & Citations

"Role of corin in trophoblast invasion and uterine spiral artery remodelling in pregnancy." Cui Y., Wang W., Dong N., Lou J., Srinivasan D.K., Cheng W., Huang X., Liu M., Fang C., Peng J., Chen S., Wu S., Liu Z., Dong L., Zhou Y., Wu Q. Nature 484:246-250 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
BNC940040-500 1x 500 µL

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF405S conjugate, 0.1mg/mL
BNC042418-500 1x 500 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL
BNC051037-100 1x 100 µL

CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), 1mg/mL
BNUM1429-50 1x 50 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), 1mg/mL

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF594 conjugate, 0.1mg/mL
BNC941860-500 1x 500 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Moesin (rMSN/492), CF594 conjugate, 0.1mg/mL
BNC942307-100 1x 100 µL

Moesin (rMSN/492), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details