Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell-specific surface glycoprotein CD28 (CD28), partial

Product Specifications

Product Name Alternative

TP44 (CD_antigen: CD28)

Abbreviation

Recombinant Human CD28 protein, partial

Gene Name

CD28

UniProt

P10747

Expression Region

19-152aa

Organism

Homo sapiens (Human)

Target Sequence

NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation. Isoform 3 enhances CD40L-mediated activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

44.1 kDa

References & Citations

"A novel costimulatory signaling in human T lymphocytes by a splice variant of CD28." Hanawa H., Ma Y., Mikolajczak S.A., Charles M.L., Yoshida T., Yoshida R., Strathdee C.A., Litchfield D.W., Ochi A. Blood 99:2138-2145 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

N-benzyl-N'-[1- (3-cyclopropyl-1,2,4-oxadiazol-5-yl) cyclohexyl]urea
sc-493718 5 mg

N-benzyl-N'-[1- (3-cyclopropyl-1,2,4-oxadiazol-5-yl) cyclohexyl]urea

Ask
View Details
IL-1β Rabbit Polyclonal Antibody
E53P01260 100 µL

IL-1β Rabbit Polyclonal Antibody

Ask
View Details
APP (Y756) (APP, A4, AD1, Amyloid beta A4 protein, ABPP, APPI, Alzheimer disease amyloid protein, Cerebral vascular amyloid peptide, PreA4, Protease nexin-II, N-APP, Soluble APP-alpha, Soluble APP-beta, C99, Beta-amyloid protein 42, Beta-APP42, Beta-amylo
MBS6274563-01 0.1 mL

APP (Y756) (APP, A4, AD1, Amyloid beta A4 protein, ABPP, APPI, Alzheimer disease amyloid protein, Cerebral vascular amyloid peptide, PreA4, Protease nexin-II, N-APP, Soluble APP-alpha, Soluble APP-beta, C99, Beta-amyloid protein 42, Beta-APP42, Beta-amylo

Ask
View Details
APP (Y756) (APP, A4, AD1, Amyloid beta A4 protein, ABPP, APPI, Alzheimer disease amyloid protein, Cerebral vascular amyloid peptide, PreA4, Protease nexin-II, N-APP, Soluble APP-alpha, Soluble APP-beta, C99, Beta-amyloid protein 42, Beta-APP42, Beta-amylo
MBS6274563-02 5x 0.1 mL

APP (Y756) (APP, A4, AD1, Amyloid beta A4 protein, ABPP, APPI, Alzheimer disease amyloid protein, Cerebral vascular amyloid peptide, PreA4, Protease nexin-II, N-APP, Soluble APP-alpha, Soluble APP-beta, C99, Beta-amyloid protein 42, Beta-APP42, Beta-amylo

Ask
View Details
Recombinant Human LHCGR Protein, N-His
YHD54901 100 μg

Recombinant Human LHCGR Protein, N-His

Ask
View Details
PEnCMV-mCherry-Linker-NFYA (human) -Myc-SV40-Neo
BZ36823 1 Vial

PEnCMV-mCherry-Linker-NFYA (human) -Myc-SV40-Neo

Ask
View Details