Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Pro-interleukin-16 [Cleaved into: Interleukin-16 protein (Il16) (Active)

Product Specifications

Product Name Alternative

IL-16, LCF, ]

Abbreviation

Recombinant Mouse Il16 protein (Active)

Gene Name

Il16

UniProt

O54824

Expression Region

1205-1322aa

Organism

Mus musculus (Mouse)

Target Sequence

SAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Interleukin-16 stimulates a migratory response in CD4+ lymphocytes, monocytes, and eosinophils. Primes CD4+ T-cells for IL-2 and IL-15 responsiveness. Also induces T-lymphocyte expression of interleukin 2 receptor. Ligand for CD4.; Isoform 1 may act as a scaffolding protein that anchors ion channels in the membrane.; Isoform 2 is involved in cell cycle progression in T-cells. Appears to be involved in transcriptional regulation of SKP2 and is probably part of a transcriptional repression complex on the core promoter of the SKP2 gene. May act as a scaffold for GABPB1 (the DNA-binding subunit the GABP transcription factor complex) and HDAC3 thus maintaining transcriptional repression and blocking cell cycle progression in resting T-cells.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>98% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral T lymphocytes is in a concentration range of 1.0-100 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Interleukin-16 stimulates a migratory response in CD4+ lymphocytes, monocytes, and eosinophils. Primes CD4+ T-cells for IL-2 and IL-15 responsiveness. Also induces T-lymphocyte expression of interleukin 2 receptor. Ligand for CD4.; FUNCTION

Molecular Weight

12.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Carotid body
CS644918 5x 5 µm

Frozen Tissue Sections, Carotid body

Sign In for Pricing
View Details
MTRFR (NM_001143905) Human Over-expression Lysate
LY428398 100 µg

MTRFR (NM_001143905) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human Profilin-2/PFN2 Protein
PKSH032935-01 10 µg

Recombinant Human Profilin-2/PFN2 Protein

Sign In for Pricing
View Details
Recombinant Human Profilin-2/PFN2 Protein
PKSH032935-02 50 µg

Recombinant Human Profilin-2/PFN2 Protein

Sign In for Pricing
View Details
KATNAL1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G1]
TA502459BM 100 µL

KATNAL1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G1]

Sign In for Pricing
View Details
CTLA4 Mouse Monoclonal Antibody [Clone ID: OTI3B11]
CF813247 100 µg

CTLA4 Mouse Monoclonal Antibody [Clone ID: OTI3B11]

Sign In for Pricing
View Details