Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

6Ckine/CCL21A, Mouse

6Ckine/CCL21A Protein, Mouse is a homeostatic lymphoid chemokine that contributes to the entry of T cells and dendritic cells into the lymphoid T-zone. It acts through chemokine receptors CCR7 and CXCR3 to promote fibrogenic and inflammatory cytokine production. 6Ckine/CCL21 Protein, Mouse is a recombinant mouse 6Ckine/CCL21A (S24-G133) expressed by E. coli[1].

Product Specifications

Product Name Alternative

6Ckine/CCL21A Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/6ckine-ccl21-protein-mouse.html

Purity

97.24

Smiles

SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG

Molecular Formula

18829 (Gene_ID) P84444 (S24-G133) (Accession)

Molecular Weight

Approximately 16-17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Balsam Rizeq, et al. The Role of CCL21/CCR7 Chemokine Axis in Breast Cancer Progression. Cancers (Basel) . 2020 Apr 23;12 (4) :1036.|[2]Knut Biber, et al. Neuronal CCL21 up-regulates microglia P2X4 expression and initiates neuropathic pain development. EMBO J. 2011 May 4;30 (9) :1864-73.|[3]Michael Hirth, et al. CXCL10 and CCL21 Promote Migration of Pancreatic Cancer Cells Toward Sensory Neurons and Neural Remodeling in Tumors in Mice, Associated With Pain in Patients. Gastroenterology. 2020 Aug;159 (2) :665-681.e13.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF405S conjugate, 0.1mg/mL
BNC040039-100 1x 100 µL

CD34 (ICO-115), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL
BNC470017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF488A conjugate, 0.1mg/mL
BNC880032-100 1x 100 µL

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF770 conjugate, 0.1mg/mL
BNC700160-100 1x 100 µL

CD20 (B9E9), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL
BNC741073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
BNC470257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details