Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

6Ckine/CCL21A, Mouse

6Ckine/CCL21A Protein, Mouse is a homeostatic lymphoid chemokine that contributes to the entry of T cells and dendritic cells into the lymphoid T-zone. It acts through chemokine receptors CCR7 and CXCR3 to promote fibrogenic and inflammatory cytokine production. 6Ckine/CCL21 Protein, Mouse is a recombinant mouse 6Ckine/CCL21A (S24-G133) expressed by E. coli[1].

Product Specifications

Product Name Alternative

6Ckine/CCL21A Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/6ckine-ccl21-protein-mouse.html

Purity

97.24

Smiles

SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG

Molecular Formula

18829 (Gene_ID) P84444 (S24-G133) (Accession)

Molecular Weight

Approximately 16-17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Balsam Rizeq, et al. The Role of CCL21/CCR7 Chemokine Axis in Breast Cancer Progression. Cancers (Basel) . 2020 Apr 23;12 (4) :1036.|[2]Knut Biber, et al. Neuronal CCL21 up-regulates microglia P2X4 expression and initiates neuropathic pain development. EMBO J. 2011 May 4;30 (9) :1864-73.|[3]Michael Hirth, et al. CXCL10 and CCL21 Promote Migration of Pancreatic Cancer Cells Toward Sensory Neurons and Neural Remodeling in Tumors in Mice, Associated With Pain in Patients. Gastroenterology. 2020 Aug;159 (2) :665-681.e13.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAR4 Antibody
3447-30T 30 µg

PAR4 Antibody

Sign In for Pricing
View Details
Human MTRNR2L10 knockdown cell line
ABC-KD9642 1 Vial

Human MTRNR2L10 knockdown cell line

Sign In for Pricing
View Details
Anti-PDE2A Rabbit pAb
GB113660 100 μL

Anti-PDE2A Rabbit pAb

Sign In for Pricing
View Details
ADAM10 sgRNA CRISPR Lentivector (Human) (Target 3)
K0041804 1.0 µg DNA

ADAM10 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Peptidyl-prolyl cis-trans isomerase A (ppiA)
MBS1434581-01 0.02 mg (E-Coli)

Recombinant Pseudomonas aeruginosa Peptidyl-prolyl cis-trans isomerase A (ppiA)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Peptidyl-prolyl cis-trans isomerase A (ppiA)
MBS1434581-02 0.1 mg (E-Coli)

Recombinant Pseudomonas aeruginosa Peptidyl-prolyl cis-trans isomerase A (ppiA)

Sign In for Pricing
View Details