Animal-Free BMP-15, Human (His)
Bone morphogenetic protein 15 (BMP-15; GDF9B), also known as growth differentiation factor 9B (GDF9B), is a polymorphic ligand protein of the TGFβ family and is only expressed in follicular cells. BMP15 is closely related to GDF9 and synergistically regulates the genetic development of follicles. BMP15 is involved in p38 MAPK and HIF-1α/SCF signaling pathway, respectively, and can up-regulate the expression of anti-Mullerian hormone (AMH) and polycystic ovarian syndrome (PCOS) related stem cell factor (SCF) in granulosa cells. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free BMP-15 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-bmp-15-protein-human-his.html
Purity
98.0
Smiles
MAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
Molecular Formula
9210 (Gene_ID) O95972 (Q268-R392) (Accession)
Molecular Weight
Approximately 13-18 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
Mucin 5AC (MUC5AC) (45M1), CF594 conjugate, 0.1mg/mL
Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL
