Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLIPR1, Mouse (HEK293, His)

GLIPR1 protein is a member of the CRISP (cysteine-rich secreted protein) family and is a multifunctional protein involved in a variety of cellular processes. It is primarily known for its role in cancer development and progression. GLIPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived GLIPR1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GLIPR1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/glipr1-protein-mouse-hek293-his.html

Purity

98.0

Smiles

SSFTASTLPDITNEDFIKECVQVHNQLRSKVSPPARNMLYMSWDPKLAQIAKAWTKSCEFKHNPQLHSRIHPNFTALGENIWLGSLSIFSVSSAISAWYEEIKHYDFSTRKCRHVCGHYTQVVWADSYKLGCAVQLCPNGANFICDYGPAGNYPTWPYKQGATCSDCPKDDKCLNSLCINPRRDQVSRYYSVDYPDWPIYLRNRYT

Molecular Formula

73690 (Gene_ID) Q9CWG1/NP_082884.1 (S18-T223) (Accession)

Molecular Weight

Approximately 27 kDa

References & Citations

[1]Tiu YC, et al. GLIPR1 promotes proliferation, metastasis and 5-fluorouracil resistance in hepatocellular carcinoma by activating the PI3K/PDK1/ROCK1 pathway. Cancer Gene Ther. 2022 Nov;29 (11) :1720-1730.|[2]Murphy EV, et al. The human glioma pathogenesis-related protein is structurally related to plant pathogenesis-related proteins and its gene is expressed specifically in brain tumors. Gene. 1995 Jun 14;159 (1) :131-5.|[3]Wang J, et al. Glioma pathogenesis-related protein 1 performs dual functions in tumor cells. Cancer Gene Ther. 2022 Mar;29 (3-4) :253-263.|[4]Giladi ND, et al. RTVP-1 promotes mesenchymal transformation of glioma via a STAT-3/IL-6-dependent positive feedback loop. Oncotarget. 2015 Sep 8;6 (26) :22680-97.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ceftiofur Sodium
C5720-01 5 g

Ceftiofur Sodium

Sign In for Pricing
View Details
Ceftiofur Sodium
C5720-02 25 g

Ceftiofur Sodium

Sign In for Pricing
View Details
Recombinant Magnetococcus sp. UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)
MBS1145819-01 0.02 mg (E-Coli)

Recombinant Magnetococcus sp. UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)

Sign In for Pricing
View Details
Recombinant Magnetococcus sp. UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)
MBS1145819-02 0.02 mg (Yeast)

Recombinant Magnetococcus sp. UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)

Sign In for Pricing
View Details
Recombinant Magnetococcus sp. UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)
MBS1145819-03 0.1 mg (E-Coli)

Recombinant Magnetococcus sp. UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)

Sign In for Pricing
View Details
Recombinant Magnetococcus sp. UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)
MBS1145819-04 0.1 mg (Yeast)

Recombinant Magnetococcus sp. UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)

Sign In for Pricing
View Details