Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLIPR1, Mouse (HEK293, His)

GLIPR1 protein is a member of the CRISP (cysteine-rich secreted protein) family and is a multifunctional protein involved in a variety of cellular processes. It is primarily known for its role in cancer development and progression. GLIPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived GLIPR1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

GLIPR1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/glipr1-protein-mouse-hek293-his.html

Purity

98.0

Smiles

SSFTASTLPDITNEDFIKECVQVHNQLRSKVSPPARNMLYMSWDPKLAQIAKAWTKSCEFKHNPQLHSRIHPNFTALGENIWLGSLSIFSVSSAISAWYEEIKHYDFSTRKCRHVCGHYTQVVWADSYKLGCAVQLCPNGANFICDYGPAGNYPTWPYKQGATCSDCPKDDKCLNSLCINPRRDQVSRYYSVDYPDWPIYLRNRYT

Molecular Formula

73690 (Gene_ID) Q9CWG1/NP_082884.1 (S18-T223) (Accession)

Molecular Weight

Approximately 27 kDa

References & Citations

[1]Tiu YC, et al. GLIPR1 promotes proliferation, metastasis and 5-fluorouracil resistance in hepatocellular carcinoma by activating the PI3K/PDK1/ROCK1 pathway. Cancer Gene Ther. 2022 Nov;29 (11) :1720-1730.|[2]Murphy EV, et al. The human glioma pathogenesis-related protein is structurally related to plant pathogenesis-related proteins and its gene is expressed specifically in brain tumors. Gene. 1995 Jun 14;159 (1) :131-5.|[3]Wang J, et al. Glioma pathogenesis-related protein 1 performs dual functions in tumor cells. Cancer Gene Ther. 2022 Mar;29 (3-4) :253-263.|[4]Giladi ND, et al. RTVP-1 promotes mesenchymal transformation of glioma via a STAT-3/IL-6-dependent positive feedback loop. Oncotarget. 2015 Sep 8;6 (26) :22680-97.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NG2/MCSP Alexa Fluor 405 Antibody (Clone 7.1)
FAB25851V-100UG 100 µg

Human NG2/MCSP Alexa Fluor 405 Antibody (Clone 7.1)

Sign In for Pricing
View Details
3- (6-Methoxypyridin-3-yl) benzoic acid
422996-01 100 mg

3- (6-Methoxypyridin-3-yl) benzoic acid

Sign In for Pricing
View Details
3- (6-Methoxypyridin-3-yl) benzoic acid
422996-02 250 mg

3- (6-Methoxypyridin-3-yl) benzoic acid

Sign In for Pricing
View Details
Lentiviral mouse Cdx1 shRNA (UAS) - Lentiviral mouse Cdx1 shRNA (UAS, RFP) (100)
GTR15176364 1 Vial

Lentiviral mouse Cdx1 shRNA (UAS) - Lentiviral mouse Cdx1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
CLDN24 sgRNA CRISPR Lentivector (Human) (Target 2)
K2760303 1.0 µg DNA

CLDN24 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
MYSM1, NT (MYSM1, KIAA1915, Histone H2A deubiquitinase MYSM1, Myb-like, SWIRM and MPN domain-containing protein 1) (FITC) discontinued
038768-FITC 200 µL

MYSM1, NT (MYSM1, KIAA1915, Histone H2A deubiquitinase MYSM1, Myb-like, SWIRM and MPN domain-containing protein 1) (FITC) discontinued

Sign In for Pricing
View Details