Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human INHbC (Inhibin Beta C) ELISA Kit

Product Specifications

CAS Number

7732-18-5

Gene Name

[INHbC]

Reactivity

Human

Storage Conditions

Store at 2-8 degree C. Stable for 6 months from date of receipt.

Specificity

This assay has high sensitivity and excellent specificity for detection of Human INHbC. No significant cross-reactivity or interference between Human INHbC and analogues was observed.

Short Name

[INHbC (Inhibin Beta C)]

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUFU Recombinant Protein (Mouse)
RP176351 100 µg

SUFU Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Human Claudin 11 (CLDN11) ELISA Kit
RDR-CLDN11-Hu-96Tests 96 Tests

Human Claudin 11 (CLDN11) ELISA Kit

Sign In for Pricing
View Details
RAI5-set siRNA/shRNA/RNAi Lentivector (Human)
66637091 4x 500 ng

RAI5-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
MF-0155879-01 5 mg

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
MF-0155879-02 50 mg

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
Vom1r19 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6283505 3x 1.0 µg

Vom1r19 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details