Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vascular endothelial growth factor A protein (VEGFA), partial (Active)

Product Specifications

Product Name Alternative

VEGF-A, VPF

Abbreviation

Recombinant Human VEGFA protein, partial (Active)

Gene Name

VEGFA

UniProt

P15692

Expression Region

27-191aa

Organism

Homo sapiens (Human)

Target Sequence

M+APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

Yeast

Field of Research

Cancer

Relevance

Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. {ECO:0000269|PubMed:11427521, ECO:0000269|PubMed:16489009}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>97% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human umbilical vein endothelial cells (HUVEC) is between 1.0-8.0 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.02 % Tween-20

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity) .

Molecular Weight

19.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform 4

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PIP (PIP1;1, PIP1;2, PIP1;3, PIP1;4, PIP1;5) aquaporins, DyLight® 594 conjugated (40 µg)
AS09 487-DL594 40 µg

Anti-PIP (PIP1;1, PIP1;2, PIP1;3, PIP1;4, PIP1;5) aquaporins, DyLight® 594 conjugated (40 µg)

Sign In for Pricing
View Details
SRC (NM_005417) Human Recombinant Protein
TP710026 20 µg

SRC (NM_005417) Human Recombinant Protein

Sign In for Pricing
View Details
Psmd4 Mouse Gene Knockout Kit (CRISPR)
KN514123 1 Kit

Psmd4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TTDA (GTF2H5) activation kit by CRISPRa
GA118391 1 Kit

Human TTDA (GTF2H5) activation kit by CRISPRa

Sign In for Pricing
View Details
X-GAL, 1 g
#10011-1 1x 1 g

X-GAL, 1 g

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS713412 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details