ZNF75A, Human (His)
The ZNF75A protein appears to be a potential influencer of transcriptional regulation, suggesting that it may play a role in shaping cellular function through gene expression control. Although the specific mechanisms and target genes affected by ZNF75A are not fully understood, its multifunctional nature in transcriptional regulation implies potential effects on a variety of cellular pathways. ZNF75A Protein, Human (His) is the recombinant human-derived ZNF75A protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
ZNF75A Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/znf75a-protein-human-his.html
Smiles
SPEFKDSAGKSPTGLKLKNDTENHQPVSLSDLEIQASAGVISKKAKVKVPQKTAGKENHFDMHRVGKWHQDFPVKKRKKLSTWKQELLKLMDRHKKDCAREKPFK
Molecular Formula
7627 (Gene_ID) Q96N20 (S58-K162) (Accession)
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog