Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF75A, Human (His)

The ZNF75A protein appears to be a potential influencer of transcriptional regulation, suggesting that it may play a role in shaping cellular function through gene expression control. Although the specific mechanisms and target genes affected by ZNF75A are not fully understood, its multifunctional nature in transcriptional regulation implies potential effects on a variety of cellular pathways. ZNF75A Protein, Human (His) is the recombinant human-derived ZNF75A protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ZNF75A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/znf75a-protein-human-his.html

Smiles

SPEFKDSAGKSPTGLKLKNDTENHQPVSLSDLEIQASAGVISKKAKVKVPQKTAGKENHFDMHRVGKWHQDFPVKKRKKLSTWKQELLKLMDRHKKDCAREKPFK

Molecular Formula

7627 (Gene_ID) Q96N20 (S58-K162) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BVES (Blood Vessel Epicardial Substance, Popeye Protein 1, POPDC1, POP1, HBVES) (MaxLight 650)
MBS6409003-01 0.1 mL

BVES (Blood Vessel Epicardial Substance, Popeye Protein 1, POPDC1, POP1, HBVES) (MaxLight 650)

Sign In for Pricing
View Details
BVES (Blood Vessel Epicardial Substance, Popeye Protein 1, POPDC1, POP1, HBVES) (MaxLight 650)
MBS6409003-02 5x 0.1 mL

BVES (Blood Vessel Epicardial Substance, Popeye Protein 1, POPDC1, POP1, HBVES) (MaxLight 650)

Sign In for Pricing
View Details
Nalidixic acid
C08463 50 mg

Nalidixic acid

Sign In for Pricing
View Details
Mouse MOSC domain containing protein 2, mitochondrial (MOSC2) ELISA Kit
GTR10340360 96 Well

Mouse MOSC domain containing protein 2, mitochondrial (MOSC2) ELISA Kit

Sign In for Pricing
View Details
Rac1 3'UTR Lenti-reporter-Luc Vector
38393086 1.0 µg

Rac1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Hydrochloric Acid 1N Solution
138300500 500 mL

Hydrochloric Acid 1N Solution

Sign In for Pricing
View Details