Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF75A, Human (His)

The ZNF75A protein appears to be a potential influencer of transcriptional regulation, suggesting that it may play a role in shaping cellular function through gene expression control. Although the specific mechanisms and target genes affected by ZNF75A are not fully understood, its multifunctional nature in transcriptional regulation implies potential effects on a variety of cellular pathways. ZNF75A Protein, Human (His) is the recombinant human-derived ZNF75A protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ZNF75A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/znf75a-protein-human-his.html

Smiles

SPEFKDSAGKSPTGLKLKNDTENHQPVSLSDLEIQASAGVISKKAKVKVPQKTAGKENHFDMHRVGKWHQDFPVKKRKKLSTWKQELLKLMDRHKKDCAREKPFK

Molecular Formula

7627 (Gene_ID) Q96N20 (S58-K162) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PKA antibody (Thr197)
MBS839455-01 0.1 mg

PKA antibody (Thr197)

Ask
View Details
PKA antibody (Thr197)
MBS839455-02 5x 0.1 mg

PKA antibody (Thr197)

Ask
View Details
LentimiRa-Off-hsa-miR-3154 Vector
mh30476 500 ng

LentimiRa-Off-hsa-miR-3154 Vector

Ask
View Details
Caprisil C8 HPLC Column, 5 µm, 100 Å, CX553-C8 x 125 mm
CX453-C8 5 µm

Caprisil C8 HPLC Column, 5 µm, 100 Å, CX553-C8 x 125 mm

Ask
View Details
TFB1M Human shRNA Plasmid Kit (Locus ID 51106)
TL306994 1 Kit

TFB1M Human shRNA Plasmid Kit (Locus ID 51106)

Ask
View Details
MTMR6, NT (MTMR6, Myotubularin-related protein 6) (APC)
MBS6322825-01 0.2 mL

MTMR6, NT (MTMR6, Myotubularin-related protein 6) (APC)

Ask
View Details