Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCRH, Human (GST)

UQCRH is an important component of the mitochondrial electron transport chain and contributes to oxidative phosphorylation within the ubiquinol-cytochrome c oxidoreductase complex. It operates in the respiratory chain, transferring electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient for ATP synthesis. UQCRH Protein, Human (GST) is the recombinant human-derived UQCRH protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

UQCRH Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/uqcrh-protein-human-gst.html

Purity

90.0

Smiles

MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK

Molecular Formula

7388 (Gene_ID) P07919 (M1-K91) (Accession)

Molecular Weight

33-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rpl28 ORF Vector (Rat) (pORF)
ORF075553 1.0 µg DNA

Rpl28 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Polyclonal Arhgef4 Antibody - N-terminal region
APR01402G 0.05mg

Polyclonal Arhgef4 Antibody - N-terminal region

Sign In for Pricing
View Details
Olfr272 3'UTR GFP Stable Cell Line
TU165082 1.0 mL

Olfr272 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PRSS16 Protein Vector (Human) (pPM-C-HA)
PV113568 500 ng

PRSS16 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis (strain 168) Phosphocarrier protein HPr
MBS1047376-01 0.02 mg (E-Coli)

Recombinant Bacillus subtilis (strain 168) Phosphocarrier protein HPr

Sign In for Pricing
View Details
Recombinant Bacillus subtilis (strain 168) Phosphocarrier protein HPr
MBS1047376-02 0.1 mg (E-Coli)

Recombinant Bacillus subtilis (strain 168) Phosphocarrier protein HPr

Sign In for Pricing
View Details