Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCRH, Human (GST)

UQCRH is an important component of the mitochondrial electron transport chain and contributes to oxidative phosphorylation within the ubiquinol-cytochrome c oxidoreductase complex. It operates in the respiratory chain, transferring electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient for ATP synthesis. UQCRH Protein, Human (GST) is the recombinant human-derived UQCRH protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

UQCRH Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/uqcrh-protein-human-gst.html

Purity

90.0

Smiles

MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK

Molecular Formula

7388 (Gene_ID) P07919 (M1-K91) (Accession)

Molecular Weight

33-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRM1 (NM_002761) Human Over-expression Lysate
LC419125 20 µg

PRM1 (NM_002761) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TACR2 (Tachykinin Receptor 2) ValidElisa Kit
EK341054 96 Well

Human TACR2 (Tachykinin Receptor 2) ValidElisa Kit

Sign In for Pricing
View Details
Canine Solute carrier family 25 member 36 (SLC25A36) ELISA Kit
MBS7247384-01 48 Well

Canine Solute carrier family 25 member 36 (SLC25A36) ELISA Kit

Sign In for Pricing
View Details
Canine Solute carrier family 25 member 36 (SLC25A36) ELISA Kit
MBS7247384-02 96 Well

Canine Solute carrier family 25 member 36 (SLC25A36) ELISA Kit

Sign In for Pricing
View Details
Canine Solute carrier family 25 member 36 (SLC25A36) ELISA Kit
MBS7247384-03 5x 96 Well

Canine Solute carrier family 25 member 36 (SLC25A36) ELISA Kit

Sign In for Pricing
View Details
Canine Solute carrier family 25 member 36 (SLC25A36) ELISA Kit
MBS7247384-04 10x 96 Well

Canine Solute carrier family 25 member 36 (SLC25A36) ELISA Kit

Sign In for Pricing
View Details