Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCRH, Human (GST)

UQCRH is an important component of the mitochondrial electron transport chain and contributes to oxidative phosphorylation within the ubiquinol-cytochrome c oxidoreductase complex. It operates in the respiratory chain, transferring electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient for ATP synthesis. UQCRH Protein, Human (GST) is the recombinant human-derived UQCRH protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

UQCRH Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/uqcrh-protein-human-gst.html

Purity

90.0

Smiles

MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK

Molecular Formula

7388 (Gene_ID) P07919 (M1-K91) (Accession)

Molecular Weight

33-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLI1 (Friend Leukemia Virus Integration 1, EWSR2, SIC-1) (MaxLight 650)
MBS6227562-01 0.1 mL

FLI1 (Friend Leukemia Virus Integration 1, EWSR2, SIC-1) (MaxLight 650)

Sign In for Pricing
View Details
FLI1 (Friend Leukemia Virus Integration 1, EWSR2, SIC-1) (MaxLight 650)
MBS6227562-02 5x 0.1 mL

FLI1 (Friend Leukemia Virus Integration 1, EWSR2, SIC-1) (MaxLight 650)

Sign In for Pricing
View Details
IL32 sgRNA CRISPR Lentivector (Human) (Target 1)
K1083502 1.0 µg DNA

IL32 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
2900026A02Rik 3'UTR GFP Stable Cell Line
TU150563 1.0 mL

2900026A02Rik 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
4-Pyrimidinesulfonyl Chloride
TRC-P997363-1G 1 g

4-Pyrimidinesulfonyl Chloride

Sign In for Pricing
View Details
Recombinant Treponema Pallidum pgsA Protein (aa 1-216) (strain Nichols)
VAng-Cr1596-inquire Inquire

Recombinant Treponema Pallidum pgsA Protein (aa 1-216) (strain Nichols)

Sign In for Pricing
View Details