Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCRH, Human (GST)

UQCRH is an important component of the mitochondrial electron transport chain and contributes to oxidative phosphorylation within the ubiquinol-cytochrome c oxidoreductase complex. It operates in the respiratory chain, transferring electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient for ATP synthesis. UQCRH Protein, Human (GST) is the recombinant human-derived UQCRH protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

UQCRH Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/uqcrh-protein-human-gst.html

Purity

90.0

Smiles

MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK

Molecular Formula

7388 (Gene_ID) P07919 (M1-K91) (Accession)

Molecular Weight

33-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPRE3
323202-01 50 µL

MAPRE3

Sign In for Pricing
View Details
MAPRE3
323202-02 100 µL

MAPRE3

Sign In for Pricing
View Details
SEC62 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62824R-BF488-01 20 µL

SEC62 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
SEC62 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62824R-BF488-02 100 µL

SEC62 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Ifi44 shRNA (UAS) - Lentiviral mouse Ifi44 shRNA (UAS, iRFP) plasmid
GTR15277264 1 Vial

Lentiviral mouse Ifi44 shRNA (UAS) - Lentiviral mouse Ifi44 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
SIGLEC7 discontinued
334257 100 µL

SIGLEC7 discontinued

Sign In for Pricing
View Details