UQCRH, Human (GST)
UQCRH is an important component of the mitochondrial electron transport chain and contributes to oxidative phosphorylation within the ubiquinol-cytochrome c oxidoreductase complex. It operates in the respiratory chain, transferring electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient for ATP synthesis. UQCRH Protein, Human (GST) is the recombinant human-derived UQCRH protein, expressed by E. coli , with N-GST labeled tag.
Product Specifications
Product Name Alternative
UQCRH Protein, Human (GST), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/uqcrh-protein-human-gst.html
Purity
90.0
Smiles
MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK
Molecular Formula
7388 (Gene_ID) P07919 (M1-K91) (Accession)
Molecular Weight
33-45 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Rat Collagen type IV Alpha 3-binding protein (COL4A3BP) ELISA Kit
Rat Collagen type IV Alpha 3-binding protein (COL4A3BP) ELISA Kit
Rat Collagen type IV Alpha 3-binding protein (COL4A3BP) ELISA Kit
Rat Collagen type IV Alpha 3-binding protein (COL4A3BP) ELISA Kit
