Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCRH, Human (GST)

UQCRH is an important component of the mitochondrial electron transport chain and contributes to oxidative phosphorylation within the ubiquinol-cytochrome c oxidoreductase complex. It operates in the respiratory chain, transferring electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient for ATP synthesis. UQCRH Protein, Human (GST) is the recombinant human-derived UQCRH protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

UQCRH Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/uqcrh-protein-human-gst.html

Purity

90.0

Smiles

MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK

Molecular Formula

7388 (Gene_ID) P07919 (M1-K91) (Accession)

Molecular Weight

33-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF707 Overexpression Lysate (Native) - (Dry Ice)
NBP2-09331 0.1 mg

ZNF707 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
ZHX1-C8orf76 Antibody, FITC conjugated
A66017-50UG 50 µg

ZHX1-C8orf76 Antibody, FITC conjugated

Sign In for Pricing
View Details
P2RX4 (NM_002560) Human Tagged ORF Clone
RC207613 10 µg

P2RX4 (NM_002560) Human Tagged ORF Clone

Sign In for Pricing
View Details
AOAH (Acyloxyacyl Hydrolase)
362132 200 µL

AOAH (Acyloxyacyl Hydrolase)

Sign In for Pricing
View Details
2310047B19Rik sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4721804 1.0 µg DNA

2310047B19Rik sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Rat Slc27a5 ELISA Kit
ELI-21748r 96 Tests

Rat Slc27a5 ELISA Kit

Sign In for Pricing
View Details