Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCRH, Human (GST)

UQCRH is an important component of the mitochondrial electron transport chain and contributes to oxidative phosphorylation within the ubiquinol-cytochrome c oxidoreductase complex. It operates in the respiratory chain, transferring electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient for ATP synthesis. UQCRH Protein, Human (GST) is the recombinant human-derived UQCRH protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

UQCRH Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/uqcrh-protein-human-gst.html

Purity

90.0

Smiles

MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK

Molecular Formula

7388 (Gene_ID) P07919 (M1-K91) (Accession)

Molecular Weight

33-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SELENBP1 protein
MBS1562256-01 0.05 mg

Recombinant Human SELENBP1 protein

Sign In for Pricing
View Details
Recombinant Human SELENBP1 protein
MBS1562256-02 0.1 mg

Recombinant Human SELENBP1 protein

Sign In for Pricing
View Details
Recombinant Human SELENBP1 protein
MBS1562256-03 5x 0.1 mg

Recombinant Human SELENBP1 protein

Sign In for Pricing
View Details
Lentiviral mouse Itgb2l shRNA (UAS) - Lentiviral mouse Itgb2l shRNA (UAS, iRFP) plasmid
GTR15108328 1 Vial

Lentiviral mouse Itgb2l shRNA (UAS) - Lentiviral mouse Itgb2l shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Dnmt1, phosphorylated (S1105) (DNMT1, AIM, CXXC9, DNMT, DNA (cytosine-5) -methyltransferase 1, CXXC-type zinc finger protein 9, DNA methyltransferase HsaI, MCMT) (MaxLight 750) discontinued
034740-ML750 100 µL

Dnmt1, phosphorylated (S1105) (DNMT1, AIM, CXXC9, DNMT, DNA (cytosine-5) -methyltransferase 1, CXXC-type zinc finger protein 9, DNA methyltransferase HsaI, MCMT) (MaxLight 750) discontinued

Sign In for Pricing
View Details
RNF6 Recombinant Protein (Human)
RP026698 100 µg

RNF6 Recombinant Protein (Human)

Sign In for Pricing
View Details