Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCRH, Human (GST)

UQCRH is an important component of the mitochondrial electron transport chain and contributes to oxidative phosphorylation within the ubiquinol-cytochrome c oxidoreductase complex. It operates in the respiratory chain, transferring electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient for ATP synthesis. UQCRH Protein, Human (GST) is the recombinant human-derived UQCRH protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

UQCRH Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/uqcrh-protein-human-gst.html

Purity

90.0

Smiles

MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK

Molecular Formula

7388 (Gene_ID) P07919 (M1-K91) (Accession)

Molecular Weight

33-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurexophilin 1, Recombinant, Rat (NXPH1)
N2110-30 50 µg

Neurexophilin 1, Recombinant, Rat (NXPH1)

Request Quote
View Details
PACE4 (PCSK6) Human Gene Knockout Kit (CRISPR)
KN213553 1 Kit

PACE4 (PCSK6) Human Gene Knockout Kit (CRISPR)

Request Quote
View Details
HOXA5 (Homeobox A5, HOX1, HOX1.3, HOX1C, MGC9376) (APC)
MBS6167768-01 0.1 mL

HOXA5 (Homeobox A5, HOX1, HOX1.3, HOX1C, MGC9376) (APC)

Request Quote
View Details
HOXA5 (Homeobox A5, HOX1, HOX1.3, HOX1C, MGC9376) (APC)
MBS6167768-02 5x 0.1 mL

HOXA5 (Homeobox A5, HOX1, HOX1.3, HOX1C, MGC9376) (APC)

Request Quote
View Details
Eph receptor A5 (EPHA5) (NM_001281766) Human Untagged Clone
SC337779 10 µg

Eph receptor A5 (EPHA5) (NM_001281766) Human Untagged Clone

Request Quote
View Details
Xpress™ Human ABCA2 Over-expressing Stable Cell Line
ABC-X0032 1 Vial

Xpress™ Human ABCA2 Over-expressing Stable Cell Line

Request Quote
View Details