Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCRH, Human (GST)

UQCRH is an important component of the mitochondrial electron transport chain and contributes to oxidative phosphorylation within the ubiquinol-cytochrome c oxidoreductase complex. It operates in the respiratory chain, transferring electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient for ATP synthesis. UQCRH Protein, Human (GST) is the recombinant human-derived UQCRH protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

UQCRH Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/uqcrh-protein-human-gst.html

Purity

90.0

Smiles

MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK

Molecular Formula

7388 (Gene_ID) P07919 (M1-K91) (Accession)

Molecular Weight

33-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Ficolin-1 Antibody (017) [Janelia Fluor 646]
NBP2-89714JF646 0.1 mL

Rabbit Monoclonal Ficolin-1 Antibody (017) [Janelia Fluor 646]

Sign In for Pricing
View Details
LEPR Antibody
A23754-50UG 50 µg

LEPR Antibody

Sign In for Pricing
View Details
CD72 Monoclonal Antibody
ANT-11315-50ug 50 µg

CD72 Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal TRPM8 Antibody [Biotin]
NBP1-97311B 0.1 mL

Rabbit Polyclonal TRPM8 Antibody [Biotin]

Sign In for Pricing
View Details
Glipr2 Mouse qPCR Primer Pair (NM_027450)
MP205453 200 Reactions

Glipr2 Mouse qPCR Primer Pair (NM_027450)

Sign In for Pricing
View Details
RARB (HAP, NR1B2, Retinoic Acid Receptor beta, RAR-beta, HBV-activated Protein, Nuclear Receptor Subfamily 1 Group B Member 2, RAR-epsilon) (MaxLight 750)
MBS6234885-01 0.1 mL

RARB (HAP, NR1B2, Retinoic Acid Receptor beta, RAR-beta, HBV-activated Protein, Nuclear Receptor Subfamily 1 Group B Member 2, RAR-epsilon) (MaxLight 750)

Sign In for Pricing
View Details