Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCRH, Human (GST)

UQCRH is an important component of the mitochondrial electron transport chain and contributes to oxidative phosphorylation within the ubiquinol-cytochrome c oxidoreductase complex. It operates in the respiratory chain, transferring electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient for ATP synthesis. UQCRH Protein, Human (GST) is the recombinant human-derived UQCRH protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

UQCRH Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/uqcrh-protein-human-gst.html

Purity

90.0

Smiles

MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK

Molecular Formula

7388 (Gene_ID) P07919 (M1-K91) (Accession)

Molecular Weight

33-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pcdha8 3'UTR Luciferase Stable Cell Line
TU215889 1.0 mL

Pcdha8 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TPRA1 Protein Vector (Mouse) (pPM-C-His)
PV241017 500 ng

TPRA1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Fas, Fc Chimera, Recombinant, Human (NFRSF6/CD95 Fc Chimera, Fibroblast-associated, Apo-1, APT1, CD95, TNFRSF6)
167648 50 µg

Fas, Fc Chimera, Recombinant, Human (NFRSF6/CD95 Fc Chimera, Fibroblast-associated, Apo-1, APT1, CD95, TNFRSF6)

Sign In for Pricing
View Details
Mmu-miR-8112 antagomir
HY-RI04160A-01 5 nmol

Mmu-miR-8112 antagomir

Sign In for Pricing
View Details
Mmu-miR-8112 antagomir
HY-RI04160A-02 20 nmol

Mmu-miR-8112 antagomir

Sign In for Pricing
View Details
CARMIL3 (NM_138360) Human Tagged ORF Clone Lentiviral Particle
RC219048L4V 200 µL

CARMIL3 (NM_138360) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details