Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCRH, Human (GST)

UQCRH is an important component of the mitochondrial electron transport chain and contributes to oxidative phosphorylation within the ubiquinol-cytochrome c oxidoreductase complex. It operates in the respiratory chain, transferring electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient for ATP synthesis. UQCRH Protein, Human (GST) is the recombinant human-derived UQCRH protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

UQCRH Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/uqcrh-protein-human-gst.html

Purity

90.0

Smiles

MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK

Molecular Formula

7388 (Gene_ID) P07919 (M1-K91) (Accession)

Molecular Weight

33-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TACC2 Mouse Monoclonal Antibody [Clone ID: LBI8A5]
AMM16465V 100 µL

TACC2 Mouse Monoclonal Antibody [Clone ID: LBI8A5]

Sign In for Pricing
View Details
ProBNP Monoclonal Antibody, AbBy Fluor™ 647 Conjugated
bsm-43095M-BF647 100 µL

ProBNP Monoclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
GCNT3, CT (GCNT3, Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3, C2GnT-mucin type, Core 2/core 4 beta-1,6-N-acetylglucosaminyltransferase) (PE) discontinued
035969-PE 200 µL

GCNT3, CT (GCNT3, Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3, C2GnT-mucin type, Core 2/core 4 beta-1,6-N-acetylglucosaminyltransferase) (PE) discontinued

Sign In for Pricing
View Details
Human REN (Renin) ELISA Kit
EH0268 96 Tests

Human REN (Renin) ELISA Kit

Sign In for Pricing
View Details
CDC42 antibody
70R-13909 100 ug

CDC42 antibody

Sign In for Pricing
View Details
Ube2j1 3'UTR GFP Stable Cell Line
TU272752 1.0 mL

Ube2j1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details