Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAK1, Human (sf9, His)

JAK1 protein is a non-receptor tyrosine kinase that plays a crucial role in IFN-α/β/γ signaling and serves as a kinase partner for IL-2 and IL-10 receptors. It cooperates with the type I interferon receptor IFNAR2 to phosphorylate and activate IFNAR2 upon interferon binding to IFNAR1-IFNAR2. JAK1 Protein, Human (sf9, His) is the recombinant human-derived JAK1 protein, expressed by sf9 insect cells , with N-His labeled tag.

Product Specifications

Product Name Alternative

JAK1 Protein, Human (sf9, His), Human, sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jak1-protein-human-sf9-his.html

Purity

95.00

Smiles

AQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSGTLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEEQN

Molecular Formula

3716 (Gene_ID) P23458 (A561-N852) (Accession)

Molecular Weight

Approximately 36 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KAL1 (Anosmin-1) ELISA kit
MBS2533352-01 24 Tests

Human KAL1 (Anosmin-1) ELISA kit

Sign In for Pricing
View Details
Human KAL1 (Anosmin-1) ELISA kit
MBS2533352-02 48 Test

Human KAL1 (Anosmin-1) ELISA kit

Sign In for Pricing
View Details
Human KAL1 (Anosmin-1) ELISA kit
MBS2533352-03 96 Tests

Human KAL1 (Anosmin-1) ELISA kit

Sign In for Pricing
View Details
Human KAL1 (Anosmin-1) ELISA kit
MBS2533352-04 5x 96 Tests

Human KAL1 (Anosmin-1) ELISA kit

Sign In for Pricing
View Details
Human KAL1 (Anosmin-1) ELISA kit
MBS2533352-05 10x 96 Tests

Human KAL1 (Anosmin-1) ELISA kit

Sign In for Pricing
View Details
OlFactory Receptor 10G8 (OR10G8) Human ELISA Kit
F5364 96 Tests

OlFactory Receptor 10G8 (OR10G8) Human ELISA Kit

Sign In for Pricing
View Details