Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOB4A/MOB1B, Human (His)

In the Hippo signaling pathway, MOB4A/MOB1B is a key activator that controls organ size and suppresses tumors by regulating proliferation and promoting apoptosis. This pathway involves a kinase cascade in which STK3/MST2 and STK4/MST1 together with the regulatory protein SAV1 activate LATS1/2. MOB4A/MOB1B Protein, Human (His) is the recombinant human-derived MOB4A/MOB1B protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MOB4A/MOB1B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mob4a-mob1b-protein-human-gst.html

Purity

98.0

Smiles

MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR

Molecular Formula

92597 (Gene_ID) Q7L9L4-1 (M1-R216) (Accession)

Molecular Weight

Approximately 24 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibin alpha (INHA) Human Gene Knockout Kit (CRISPR)
KN402819 1 Kit

Inhibin alpha (INHA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(AlphaS)-Alpha-Ethyl-2,5-dihydro-2-oxo-4-propyl-1H-pyrrole-1-acetic Acid
TRC-E945345-50MG 50 mg

(AlphaS)-Alpha-Ethyl-2,5-dihydro-2-oxo-4-propyl-1H-pyrrole-1-acetic Acid

Sign In for Pricing
View Details
ARNT Rabbit Monoclonal Antibody [Clone ID: 23GB660]
TA424850 100 µL

ARNT Rabbit Monoclonal Antibody [Clone ID: 23GB660]

Sign In for Pricing
View Details
2-(2,3,5-Tri-O-benzoyl-Beta-D-ribofuranosyl)-4-thiazolecarboxylic Acid Ethyl Ester
TRC-T767710-250MG 250 mg

2-(2,3,5-Tri-O-benzoyl-Beta-D-ribofuranosyl)-4-thiazolecarboxylic Acid Ethyl Ester

Sign In for Pricing
View Details
Human ApoA5 (Apolipoprotein A5) CLIA Kit
E-CL-H0388-01 24 Tests

Human ApoA5 (Apolipoprotein A5) CLIA Kit

Sign In for Pricing
View Details
Human ApoA5 (Apolipoprotein A5) CLIA Kit
E-CL-H0388-02 48 Tests

Human ApoA5 (Apolipoprotein A5) CLIA Kit

Sign In for Pricing
View Details