Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOB4A/MOB1B, Human (His)

In the Hippo signaling pathway, MOB4A/MOB1B is a key activator that controls organ size and suppresses tumors by regulating proliferation and promoting apoptosis. This pathway involves a kinase cascade in which STK3/MST2 and STK4/MST1 together with the regulatory protein SAV1 activate LATS1/2. MOB4A/MOB1B Protein, Human (His) is the recombinant human-derived MOB4A/MOB1B protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MOB4A/MOB1B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mob4a-mob1b-protein-human-gst.html

Purity

98.0

Smiles

MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR

Molecular Formula

92597 (Gene_ID) Q7L9L4-1 (M1-R216) (Accession)

Molecular Weight

Approximately 24 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDC, NT (HDC, Histidine decarboxylase) (PE)
MBS6305965-01 0.2 mL

HDC, NT (HDC, Histidine decarboxylase) (PE)

Sign In for Pricing
View Details
HDC, NT (HDC, Histidine decarboxylase) (PE)
MBS6305965-02 5x 0.2 mL

HDC, NT (HDC, Histidine decarboxylase) (PE)

Sign In for Pricing
View Details
Human SPINLW1 (EPPIN) (NM_020398) AAV Particle
RC206458A1V 250 µL

Human SPINLW1 (EPPIN) (NM_020398) AAV Particle

Sign In for Pricing
View Details
n-Propyl-d7-amine HCl
H953789 10 mg

n-Propyl-d7-amine HCl

Sign In for Pricing
View Details
Human SLC9C2 activation kit by CRISPRa
GA117162 1 Kit

Human SLC9C2 activation kit by CRISPRa

Sign In for Pricing
View Details
PMM2 Antibody
MBS7044653-01 0.05 mL

PMM2 Antibody

Sign In for Pricing
View Details