Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD40L/CD154/TRAP, Rabbit (His)

CD40L (CD154; TRAP) is a ligand to CD40/TNFRSF5, acts function by generating a costimulatory signal that up-regulates IL-4 synthesis[1]. CD40L is specifically expressed on activated CD4+ T-lymphocytes and involves in activation of NF-κB/MAPK pathway[2][3]. CD40L also involves in B cell differentiation, maturation, and apoptosis[4]. CD40L in Rabbit, cleaved into a soluble form, acts as a ligand for integrins (ITGA5:ITGB1 and ITGAV:ITGB3) . CD40L/CD154/TRAP Protein, Rabbit (His) has a total length of 149 amino acids (M113-L261), is expressed in E. coli cells with N-terminal 6*His-tag.

Product Specifications

Product Name Alternative

CD40L/CD154/TRAP Protein, Rabbit (His), Rabbit, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd40l-cd154-trap-protein-rabbit-his.html

Purity

94.00

Smiles

MQKGDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKL

Molecular Formula

100358388 (Gene_ID) G1SKP7 (M113-L261) (Accession)

Molecular Weight

Approximately 20.2 kDa

References & Citations

[1]Blotta MH, et al. Cross-linking of the CD40 ligand on human CD4+ T lymphocytes generates a costimulatory signal that up-regulates IL-4 synthesis. J Immunol. 1996 May 1;156 (9) :3133-40.|[2]Schwabe RF, et al. CD40 activates NF-kappa B and c-Jun N-terminal kinase and enhances chemokine secretion on activated human hepatic stellate cells. J Immunol. 2001 Jun 1;166 (11) :6812-9.|[3]Batlle A, et al. CD40 and B-cell receptor signalling induce MAPK family members that can either induce or repress Bcl-6 expression. Mol Immunol. 2009 May;46 (8-9) :1727-35.|[4]Mikolajczak SA, et al. The modulation of CD40 ligand signaling by transmembrane CD28 splice variant in human T cells. J Exp Med. 2004 Apr 5;199 (7) :1025-31.|[5]Takada YK, et al. Soluble CD40L activates soluble and cell-surface integrin αvβ3, α5β1, and α4β1 by binding to the allosteric ligand-binding site (site 2) . J Biol Chem. 2021 Jan-Jun;296:100399.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cyclin-F (CCNF) Rat ELISA Kit
C7002 96 Tests

Cyclin-F (CCNF) Rat ELISA Kit

Ask
View Details
Frozen Tissue Blocks, Breast
CB645829 1 Block

Frozen Tissue Blocks, Breast

Ask
View Details
TMEM39A (NM_018266) Human Tagged ORF Clone Lentiviral Particle
RC205662L1V 200 µL

TMEM39A (NM_018266) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Rabbit Polyclonal p62/SQSTM1 Antibody [Alexa Fluor 700]
NBP1-48320AF700 0.1 mL

Rabbit Polyclonal p62/SQSTM1 Antibody [Alexa Fluor 700]

Ask
View Details