Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-20R beta, Cynomolgus (HEK293, His)

IL-20R beta Protein (IL20RB) is the beta subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway[1]. The IL-20RA/IL-20RB dimer is a receptor for IL-19, IL-20 and IL-24. The IL-22RA1/IL-20RB dimer is a receptor for IL-20 and IL-24[2]. IL-20R beta Protein is consists of 308 amino acids (M1-S311) with a transmembrane domain (230-254 a.a.) . IL-20R beta Protein, Cynomolgus (HEK293, Fc) is fibronectin type-III domain-containing protein, produced in HEK293 cells with a C-Terminal Fc-tag.

Product Specifications

Product Name Alternative

IL-20R beta Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-20r-beta-protein-cynomolgus-hek293-his.html

Purity

96.00

Smiles

DEVAILPAPQNLSVLSTNMKHLLMWSPVTVPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTPPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEA

Molecular Formula

102119675 (Gene_ID) XP_005545913.1 (D30-A230) (Accession)

Molecular Weight

Approximately 29-35 kDa due to the glycosylation

References & Citations

[1]Blumberg H, et al. Interleukin 20: discovery, receptor identification, and role in epidermal function. Cell. 2001 Jan 12;10 4 (1) :9-19.|[2]Wegenka UM. IL-20: biological functions mediated through two types of receptor complexes. Cytokine Growth Factor Rev. 2010 Oct;21 (5) :353-63.|[3]Sheikh F, et al. Cutting edge: IL-26 signals through a novel receptor complex composed of IL-20 receptor 1 and IL-10 receptor 2. J Immunol. 2004 Feb 15;172 (4) :2006-10.|[4]Wang M, et al. Interleukin-24 and its receptors. Immunology. 2005 Feb;114 (2) :166-70.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL
BNC470146-500 1x 500 µL

CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Golgi Complex (371-4), CF568 conjugate, 0.1mg/mL
BNC680102-100 1x 100 µL

Golgi Complex (371-4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-L) (NFL/736), CF647 conjugate, 0.1mg/mL
SOX10 (SOX10/991), CF405S conjugate, 0.1mg/mL
BNC040991-100 1x 100 µL

SOX10 (SOX10/991), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (8C8), CF405M conjugate, 0.1mg/mL
BNC050005-100 1x 100 µL

Bcl-2 (8C8), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details