MCP-4/CCL13, Human
MCP-4/CCL13 Protein, Human is a CC family chemokine with chemotactic effects on basophils, monocytes, macrophages, immature dendritic cells and T cells. CCL13 binds to CCR1, CCR2, CCR3, CCR5, and CCR11 chemokine receptors and is able to induce key immunomodulatory responses through its effects on regulatory muscle, epithelial, and endothelial cells. MCP-4/CCL13 Protein, Human is a recombinant human MCP-4/CCL13 (Q24-T98) protein expressed by E.coli[1][2].
Product Specifications
Product Name Alternative
MCP-4/CCL13 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mcp-4-ccl13-protein-human.html
Purity
96.0
Smiles
QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Molecular Formula
6357 (Gene_ID) Q99616 (Q24-T98) (Accession)
Molecular Weight
Approximately 12.6 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CD35 / CR1 (CR1/802), Biotin conjugate, 0.1mg/mL
Uncoated Human FAPα (Fibroblast Activation Protein Alpha) ELISA Kit
Uncoated Human FAPα (Fibroblast Activation Protein Alpha) ELISA Kit
![Cyclophilin F (PPIF) Mouse Monoclonal Antibody [Clone ID: OTI1G8]](https://cdn.genprice.uk/products/937/68dd18ba061270361e9084b7/imageurl/cf809070.webp)