Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF121, Human (HEK293, His)

VEGF121 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A) . VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF121 Protein, Human (121a.a, HEK293, His) is the recombinant human-derived VEGF121 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VEGF121 Protein, Human (121a.a, HEK293, His) is 121 a.a., with molecular weight of 16-18 kDa.

Product Specifications

Product Name Alternative

VEGF121 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf121-protein-human-115a-a-hek-293-his.html

Purity

98.0

Smiles

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

Molecular Formula

7422 (Gene_ID) P15692-9 (A27-R147) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epidermal Growth Factor (EGF) (HRP)
MBS6474496-01 0.1 mL

Epidermal Growth Factor (EGF) (HRP)

Sign In for Pricing
View Details
Epidermal Growth Factor (EGF) (HRP)
MBS6474496-02 5x 0.1 mL

Epidermal Growth Factor (EGF) (HRP)

Sign In for Pricing
View Details
TMEM134 Protein Lysate (Mouse) with C-HA Tag
46893035 100 µg

TMEM134 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Desmocollin 3
D3221-52 50 µg

Desmocollin 3

Sign In for Pricing
View Details
Human SIRT2 Pre-designed siRNA Set B
SI014806B 1 Each

Human SIRT2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) Recombinant Rabbit Monoclonal Antibody (Clone:KRT19/1959R)
12-1158-100 100 µg

Anti-Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) Recombinant Rabbit Monoclonal Antibody (Clone:KRT19/1959R)

Sign In for Pricing
View Details