Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF121, Human (HEK293, His)

VEGF121 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A) . VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF121 Protein, Human (121a.a, HEK293, His) is the recombinant human-derived VEGF121 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VEGF121 Protein, Human (121a.a, HEK293, His) is 121 a.a., with molecular weight of 16-18 kDa.

Product Specifications

Product Name Alternative

VEGF121 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf121-protein-human-115a-a-hek-293-his.html

Purity

98.0

Smiles

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

Molecular Formula

7422 (Gene_ID) P15692-9 (A27-R147) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCAF17 Protein Vector (Human) (pPB-C-His)
PV072285 500 ng

DCAF17 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
RN5S88 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV743313 1.0 µg DNA

RN5S88 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
ICP Std Ytterbium 1000ug/mL in 2-5% HNO3 - 250ML
PYB2B2 250 mL

ICP Std Ytterbium 1000ug/mL in 2-5% HNO3 - 250ML

Sign In for Pricing
View Details
Urod (NM_009478) Mouse Tagged ORF Clone Lentiviral Particle
MR218752L3V 200 µL

Urod (NM_009478) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ESE1 Recombinant Antibody, APC Conjugated
bsm-62306R-APC 100 µL

ESE1 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Tcl1b1 shRNA (UAS) - Lentiviral mouse Tcl1b1 shRNA (UAS) (100)
GTR15181794 1 Vial

Lentiviral mouse Tcl1b1 shRNA (UAS) - Lentiviral mouse Tcl1b1 shRNA (UAS) (100)

Sign In for Pricing
View Details