VEGF121, Human (HEK293, His)
VEGF121 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A) . VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF121 Protein, Human (121a.a, HEK293, His) is the recombinant human-derived VEGF121 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VEGF121 Protein, Human (121a.a, HEK293, His) is 121 a.a., with molecular weight of 16-18 kDa.
Product Specifications
Product Name Alternative
VEGF121 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/vegf121-protein-human-115a-a-hek-293-his.html
Purity
98.0
Smiles
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR
Molecular Formula
7422 (Gene_ID) P15692-9 (A27-R147) (Accession)
Molecular Weight
Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
IGFN1 (Immunoglobulin-like and Fibronectin Type III Domain-containing Protein 1, EEF1A2-binding Protein 1, KY-interacting Protein 1, EEF1A2BP1, KYIP1, DKFZp434B1231)
IGFN1 (Immunoglobulin-like and Fibronectin Type III Domain-containing Protein 1, EEF1A2-binding Protein 1, KY-interacting Protein 1, EEF1A2BP1, KYIP1, DKFZp434B1231)
