VEGF121, Human (HEK293, His)
VEGF121 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A) . VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF121 Protein, Human (121a.a, HEK293, His) is the recombinant human-derived VEGF121 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VEGF121 Protein, Human (121a.a, HEK293, His) is 121 a.a., with molecular weight of 16-18 kDa.
Product Specifications
Product Name Alternative
VEGF121 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/vegf121-protein-human-115a-a-hek-293-his.html
Purity
98.0
Smiles
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR
Molecular Formula
7422 (Gene_ID) P15692-9 (A27-R147) (Accession)
Molecular Weight
Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YFL054C (YFL054C)
Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YFL054C (YFL054C)
Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YFL054C (YFL054C)
