Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF121, Human (HEK293, His)

VEGF121 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A) . VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF121 Protein, Human (121a.a, HEK293, His) is the recombinant human-derived VEGF121 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VEGF121 Protein, Human (121a.a, HEK293, His) is 121 a.a., with molecular weight of 16-18 kDa.

Product Specifications

Product Name Alternative

VEGF121 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf121-protein-human-115a-a-hek-293-his.html

Purity

98.0

Smiles

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

Molecular Formula

7422 (Gene_ID) P15692-9 (A27-R147) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cancerous Inhibitor Of PP2A ELISA Kit
MBS3809662-01 48 Well

Rat Cancerous Inhibitor Of PP2A ELISA Kit

Sign In for Pricing
View Details
Rat Cancerous Inhibitor Of PP2A ELISA Kit
MBS3809662-02 96 Well

Rat Cancerous Inhibitor Of PP2A ELISA Kit

Sign In for Pricing
View Details
Rat Cancerous Inhibitor Of PP2A ELISA Kit
MBS3809662-03 5x 96 Well

Rat Cancerous Inhibitor Of PP2A ELISA Kit

Sign In for Pricing
View Details
Rat Cancerous Inhibitor Of PP2A ELISA Kit
MBS3809662-04 10x 96 Well

Rat Cancerous Inhibitor Of PP2A ELISA Kit

Sign In for Pricing
View Details
GUCY1B3 (Guanylate Cyclase 1 Beta 3, GUCB3, GC-SB3, GUC1B3, GUCSB3, GUCY1B1, GC-S-beta-1) (PE)
MBS6419730-01 0.1 mL

GUCY1B3 (Guanylate Cyclase 1 Beta 3, GUCB3, GC-SB3, GUC1B3, GUCSB3, GUCY1B1, GC-S-beta-1) (PE)

Sign In for Pricing
View Details
GUCY1B3 (Guanylate Cyclase 1 Beta 3, GUCB3, GC-SB3, GUC1B3, GUCSB3, GUCY1B1, GC-S-beta-1) (PE)
MBS6419730-02 5x 0.1 mL

GUCY1B3 (Guanylate Cyclase 1 Beta 3, GUCB3, GC-SB3, GUC1B3, GUCSB3, GUCY1B1, GC-S-beta-1) (PE)

Sign In for Pricing
View Details