Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF121, Human (HEK293, His)

VEGF121 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A) . VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF121 Protein, Human (121a.a, HEK293, His) is the recombinant human-derived VEGF121 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VEGF121 Protein, Human (121a.a, HEK293, His) is 121 a.a., with molecular weight of 16-18 kDa.

Product Specifications

Product Name Alternative

VEGF121 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf121-protein-human-115a-a-hek-293-his.html

Purity

98.0

Smiles

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

Molecular Formula

7422 (Gene_ID) P15692-9 (A27-R147) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LENG4 (MBOAT7) (NM_024298) Human 3' UTR Clone
SC208468 10 µg

LENG4 (MBOAT7) (NM_024298) Human 3' UTR Clone

Sign In for Pricing
View Details
MHC Class 2 (MHC Class II)
M3887-09 250 µg

MHC Class 2 (MHC Class II)

Sign In for Pricing
View Details
Mouse Monoclonal Coagulation Factor XI Antibody (MM0193-7C38)
NBP2-12199 0.1 mg

Mouse Monoclonal Coagulation Factor XI Antibody (MM0193-7C38)

Sign In for Pricing
View Details
GENLISA™ Human Keratin 2 (CK2) ELISA
KBH20485 96 Well

GENLISA™ Human Keratin 2 (CK2) ELISA

Sign In for Pricing
View Details
Recombinant Carica papaya NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic
MBS7023009-01 0.02 mg

Recombinant Carica papaya NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Sign In for Pricing
View Details
Recombinant Carica papaya NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic
MBS7023009-02 0.1 mg

Recombinant Carica papaya NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Sign In for Pricing
View Details