Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF121, Human (HEK293, His)

VEGF121 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A) . VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF121 Protein, Human (121a.a, HEK293, His) is the recombinant human-derived VEGF121 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VEGF121 Protein, Human (121a.a, HEK293, His) is 121 a.a., with molecular weight of 16-18 kDa.

Product Specifications

Product Name Alternative

VEGF121 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf121-protein-human-115a-a-hek-293-his.html

Purity

98.0

Smiles

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

Molecular Formula

7422 (Gene_ID) P15692-9 (A27-R147) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE3C Adenovirus (Human)
49019051 1.0 mL

UBE3C Adenovirus (Human)

Sign In for Pricing
View Details
Mouse SLC4A1 siRNA
abx934047-01 15 nmol

Mouse SLC4A1 siRNA

Sign In for Pricing
View Details
Mouse SLC4A1 siRNA
abx934047-02 30 nmol

Mouse SLC4A1 siRNA

Sign In for Pricing
View Details
MTRNR2L6 (NM_001190487) Human Tagged Lenti ORF Clone
RC230906L4 10 µg

MTRNR2L6 (NM_001190487) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)
MBS2150252-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)
MBS2150252-02 0.2 mL

APC_Cy7-Linked Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)

Sign In for Pricing
View Details