Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF121, Human (HEK293, His)

VEGF121 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A) . VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF121 Protein, Human (121a.a, HEK293, His) is the recombinant human-derived VEGF121 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VEGF121 Protein, Human (121a.a, HEK293, His) is 121 a.a., with molecular weight of 16-18 kDa.

Product Specifications

Product Name Alternative

VEGF121 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf121-protein-human-115a-a-hek-293-his.html

Purity

98.0

Smiles

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

Molecular Formula

7422 (Gene_ID) P15692-9 (A27-R147) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD300LB 3'UTR Luciferase Stable Cell Line
TU003949 1.0 mL

CD300LB 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Glul sgRNA CRISPR Lentivector set (Rat)
K7577201 3x 1.0 µg

Glul sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Benzalkonium Chloride 50% w/v Aqueous Solution Extrapure
00367 00500 500 mL

Benzalkonium Chloride 50% w/v Aqueous Solution Extrapure

Sign In for Pricing
View Details
Ent-Edoxaban
TRC-E555535-25MG 25 mg

Ent-Edoxaban

Sign In for Pricing
View Details
WIZ Protein Vector (Mouse) (pPM-C-His)
PV247501 500 ng

WIZ Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
LINC00444 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV731719 1.0 µg DNA

LINC00444 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details