Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF121, Human (HEK293, His)

VEGF121 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A) . VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF121 Protein, Human (121a.a, HEK293, His) is the recombinant human-derived VEGF121 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VEGF121 Protein, Human (121a.a, HEK293, His) is 121 a.a., with molecular weight of 16-18 kDa.

Product Specifications

Product Name Alternative

VEGF121 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf121-protein-human-115a-a-hek-293-his.html

Purity

98.0

Smiles

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

Molecular Formula

7422 (Gene_ID) P15692-9 (A27-R147) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SETDB1 rabbit polyclonal antibody, Aff - Purified
AP07866PU-N 50 µg

SETDB1 rabbit polyclonal antibody, Aff - Purified

Sign In for Pricing
View Details
RNF14 Protein Vector (Mouse) (pPB-N-His)
PV224655 500 ng

RNF14 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Influenza A H1N1 HA1 antibody
10R-7995 100 ug

Influenza A H1N1 HA1 antibody

Sign In for Pricing
View Details
Syt3 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4807903 1.0 µg DNA

Syt3 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Monkeypox Virus Nucleic Acid Detection Kit (Fluorescence PCR)
HWTS-OT071A 1 Kit

Monkeypox Virus Nucleic Acid Detection Kit (Fluorescence PCR)

Sign In for Pricing
View Details
UGT2B11 Antibody (C-term) [APR10634G]
APR10634G-01 50 µL

UGT2B11 Antibody (C-term) [APR10634G]

Sign In for Pricing
View Details