Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF121, Human (HEK293, His)

VEGF121 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A) . VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF121 Protein, Human (121a.a, HEK293, His) is the recombinant human-derived VEGF121 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VEGF121 Protein, Human (121a.a, HEK293, His) is 121 a.a., with molecular weight of 16-18 kDa.

Product Specifications

Product Name Alternative

VEGF121 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf121-protein-human-115a-a-hek-293-his.html

Purity

98.0

Smiles

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

Molecular Formula

7422 (Gene_ID) P15692-9 (A27-R147) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MINPP1 CytoSection
TS407581P5 25 Slides

MINPP1 CytoSection

Sign In for Pricing
View Details
Thyroperoxidase Rabbit Polyclonal Antibody
JOT-AP05104-01 50ul

Thyroperoxidase Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Thyroperoxidase Rabbit Polyclonal Antibody
JOT-AP05104-02 100ul

Thyroperoxidase Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LDHA Recombinant Antibody, RBITC Conjugated
bsm-62875R-RBITC 100 µL

LDHA Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
TMEM128 Protein Vector (Rat) (pPB-N-His)
PV311315 500 ng

TMEM128 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Rgag4 3'UTR Lenti-reporter-Luc Vector
38893084 1.0 µg

Rgag4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details