Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF121, Human (HEK293, His)

VEGF121 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A) . VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF121 Protein, Human (121a.a, HEK293, His) is the recombinant human-derived VEGF121 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VEGF121 Protein, Human (121a.a, HEK293, His) is 121 a.a., with molecular weight of 16-18 kDa.

Product Specifications

Product Name Alternative

VEGF121 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf121-protein-human-115a-a-hek-293-his.html

Purity

98.0

Smiles

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

Molecular Formula

7422 (Gene_ID) P15692-9 (A27-R147) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apo E-ELISA Kits (human, mouse, rat)
ApoE-ELISA 96 Tests

Apo E-ELISA Kits (human, mouse, rat)

Sign In for Pricing
View Details
Gl Syn Rabbit Polyclonal Antibody
E53P05048 100 µL

Gl Syn Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PrP (Prion Protein, Prion, CD230, Cluster of Differentiation 230) (HRP)
301456-HRP 100 µL

PrP (Prion Protein, Prion, CD230, Cluster of Differentiation 230) (HRP)

Sign In for Pricing
View Details
Peripherin (PRPH) ELISA Kit
MBS2709537-01 24 Strip Well

Peripherin (PRPH) ELISA Kit

Sign In for Pricing
View Details
Peripherin (PRPH) ELISA Kit
MBS2709537-02 48 Well

Peripherin (PRPH) ELISA Kit

Sign In for Pricing
View Details
Peripherin (PRPH) ELISA Kit
MBS2709537-03 96 Well

Peripherin (PRPH) ELISA Kit

Sign In for Pricing
View Details