Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF121, Human (HEK293, His)

VEGF121 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A) . VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF121 Protein, Human (121a.a, HEK293, His) is the recombinant human-derived VEGF121 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VEGF121 Protein, Human (121a.a, HEK293, His) is 121 a.a., with molecular weight of 16-18 kDa.

Product Specifications

Product Name Alternative

VEGF121 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf121-protein-human-115a-a-hek-293-his.html

Purity

98.0

Smiles

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

Molecular Formula

7422 (Gene_ID) P15692-9 (A27-R147) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-(Morpholinosulfonyl)pyridi ne-3-boronic acid pinacol ester
MBS9025078-01 1 g

5-(Morpholinosulfonyl)pyridi ne-3-boronic acid pinacol ester

Sign In for Pricing
View Details
5-(Morpholinosulfonyl)pyridi ne-3-boronic acid pinacol ester
MBS9025078-02 5x 1 g

5-(Morpholinosulfonyl)pyridi ne-3-boronic acid pinacol ester

Sign In for Pricing
View Details
RGD1565059 3'UTR Lenti-reporter-Luc Vector
39386086 1.0 µg

RGD1565059 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
RGL2 Human shRNA Plasmid Kit (Locus ID 5863)
TL309849 1 Kit

RGL2 Human shRNA Plasmid Kit (Locus ID 5863)

Sign In for Pricing
View Details
Rat EHHADH shRNA Plasmid
abx987711-01 150 µg

Rat EHHADH shRNA Plasmid

Sign In for Pricing
View Details
Rat EHHADH shRNA Plasmid
abx987711-02 300 µg

Rat EHHADH shRNA Plasmid

Sign In for Pricing
View Details