Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF121, Human (HEK293, His)

VEGF121 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A) . VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF121 Protein, Human (121a.a, HEK293, His) is the recombinant human-derived VEGF121 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VEGF121 Protein, Human (121a.a, HEK293, His) is 121 a.a., with molecular weight of 16-18 kDa.

Product Specifications

Product Name Alternative

VEGF121 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf121-protein-human-115a-a-hek-293-his.html

Purity

98.0

Smiles

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

Molecular Formula

7422 (Gene_ID) P15692-9 (A27-R147) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNU1-22P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV746128 1.0 µg DNA

RNU1-22P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
PLK1 Rabbit Monoclonal Antibody
AMRe03292-01 1 Each

PLK1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PLK1 Rabbit Monoclonal Antibody
AMRe03292-02 50 µL

PLK1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PLK1 Rabbit Monoclonal Antibody
AMRe03292-03 100 µL

PLK1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
JAK3 (6B5) Mouse Monoclonal Antibody
E28PM33098 100 µL

JAK3 (6B5) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Syntrophin alpha 1 (SNTA1) Mouse Monoclonal Antibody [Clone ID: OTI2E12]
TA502040 100 µL

Syntrophin alpha 1 (SNTA1) Mouse Monoclonal Antibody [Clone ID: OTI2E12]

Sign In for Pricing
View Details