Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG1, Human (HEK293, His)

VSIG1 Protein is a member of the adhesion molecule (JAM) family and is expressed in the normal stomach and testes, as well as in cancers of the stomach, esophagus, and ovary. VSIG1 Protein mediates the activation of Wnt/-catenin signaling pathway, which has tumor inhibition function and reduces the proliferation and migration ability of tumor cells. VSIG1 Protein, Human (HEK293, His) is the recombinant human-derived VSIG1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

VSIG1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsig1-protein-human-hek-293-his.html

Smiles

VQVTIPDGFVNVTVGSNVTLICIYTTTVASREQLSIQWSFFHKKEMEPISIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPVKENFNPTTGILVIGNLTNFEQGYYQCTAINRLGNSSCEIDLTSSHPE

Molecular Formula

340547 (Gene_ID) Q86XK7-1 (V22-E232) (Accession)

Molecular Weight

Approximately 26.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human KDM4B Protein, N-His
HF804012-01 50 µg

Recombinant Human KDM4B Protein, N-His

Ask
View Details
Recombinant Human KDM4B Protein, N-His
HF804012-02 100 µg

Recombinant Human KDM4B Protein, N-His

Ask
View Details
Recombinant Human KDM4B Protein, N-His
HF804012-03 1 mg

Recombinant Human KDM4B Protein, N-His

Ask
View Details
Lentiviral mouse Mapkapk3 shRNA (UAS) - Lentiviral mouse Mapkapk3 shRNA (UAS) plasmid
GTR15235987 1 Vial

Lentiviral mouse Mapkapk3 shRNA (UAS) - Lentiviral mouse Mapkapk3 shRNA (UAS) plasmid

Ask
View Details
Lentiviral human FXYD3 shRNA (UAS) - Lentiviral human FXYD3 shRNA (UAS, RFP) (25)
GTR15101123 1 Vial

Lentiviral human FXYD3 shRNA (UAS) - Lentiviral human FXYD3 shRNA (UAS, RFP) (25)

Ask
View Details
Lentiviral mouse Kansl1l shRNA (UAS) - Lentiviral mouse Kansl1l shRNA (UAS, RFP) (100)
GTR15280692 1 Vial

Lentiviral mouse Kansl1l shRNA (UAS) - Lentiviral mouse Kansl1l shRNA (UAS, RFP) (100)

Ask
View Details