Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BamA, E.coli (Myc, His)

BamA is a key member of the outer membrane protein assembly complex (Bam), which concentrates the assembly of β-barrel proteins into the outer membrane. Together with BamD, BamA forms the core mechanism of this process, which relies on the coordinated action of all five subunits. BamA Protein, E.coli (Myc, His) is the recombinant E. coli-derived BamA protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

BamA Protein, E.coli (Myc, His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bama-protein-e-coli-myc-his.html

Purity

98.00

Smiles

AEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTG

Molecular Formula

944870 (Gene_ID) P0A940 (A175-G424) (Accession)

Molecular Weight

Approximately 36.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKAP9 (C-term) Goat Polyclonal Antibody
AP16328PU-N 100 µg

AKAP9 (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin, pan (KRTL/1077 + KRTH/1076), CF740 conjugate, 0.1mg/mL
BNC741100-100 1x 100 µL

Cytokeratin, pan (KRTL/1077 + KRTH/1076), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histidase (HAL) (NM_002108) Human Recombinant Protein
TP311651M 100 µg

Histidase (HAL) (NM_002108) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast, right
CS712692 5x 5 µm

Tissue FFPE Sections, Breast, right

Sign In for Pricing
View Details
Rgcc (NM_025427) Mouse Tagged ORF Clone
MG200841 10 µg

Rgcc (NM_025427) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mogamulizumab Biosimilar - Research Grade
ICH5186-20mg 20 mg

Mogamulizumab Biosimilar - Research Grade

Sign In for Pricing
View Details