Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BamA, E.coli (Myc, His)

BamA is a key member of the outer membrane protein assembly complex (Bam), which concentrates the assembly of β-barrel proteins into the outer membrane. Together with BamD, BamA forms the core mechanism of this process, which relies on the coordinated action of all five subunits. BamA Protein, E.coli (Myc, His) is the recombinant E. coli-derived BamA protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

BamA Protein, E.coli (Myc, His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bama-protein-e-coli-myc-his.html

Purity

98.00

Smiles

AEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTG

Molecular Formula

944870 (Gene_ID) P0A940 (A175-G424) (Accession)

Molecular Weight

Approximately 36.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmoglein-3 (Squamous Cell Marker) (DSG3/2839), CF740 conjugate, 0.1mg/mL
BNC742839-500 1x 500 µL

Desmoglein-3 (Squamous Cell Marker) (DSG3/2839), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human AKAP8L activation kit by CRISPRa
GA108955 1 Kit

Human AKAP8L activation kit by CRISPRa

Sign In for Pricing
View Details
2-Bromo-1-(3-fluorophenyl)propan-1-one
TRC-B683375-50MG 50 mg

2-Bromo-1-(3-fluorophenyl)propan-1-one

Sign In for Pricing
View Details
Mitragynine
TRC-M373550-5MG 5 Each

Mitragynine

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (rEGP40/1372), CF488A conjugate, 0.1mg/mL
BNC882172-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (rEGP40/1372), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human B9D1 activation kit by CRISPRa
GA108995 1 Kit

Human B9D1 activation kit by CRISPRa

Sign In for Pricing
View Details