Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Epididymal secretory glutathione peroxidase (GPX5)

Product Specifications

Product Name Alternative

Epididymis-specific glutathione peroxidase-like protein

Abbreviation

Recombinant Human GPX5 protein

Gene Name

GPX5

UniProt

O75715

Expression Region

1-100aa

Organism

Homo sapiens (Human)

Target Sequence

MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM

Tag

N-terminal 6xHis-GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGLN1 (NM_022051) Human Over-expression Lysate
LC402911 20 µg

EGLN1 (NM_022051) Human Over-expression Lysate

Sign In for Pricing
View Details
1,3,7-Trimethyluric acid (Standard)
HY-113327R 1 Each

1,3,7-Trimethyluric acid (Standard)

Sign In for Pricing
View Details
Reg2 Mouse Gene Knockout Kit (CRISPR)
KN514649 1 Kit

Reg2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rabbit Anti-IRX3 Polyclonal Antibody
PAV8341 100 μL

Rabbit Anti-IRX3 Polyclonal Antibody

Sign In for Pricing
View Details
Cda sgRNA CRISPR Lentivector set (Rat)
K6736301 3x 1.0 µg

Cda sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
INHBE Rabbit pAb
E47R16658 100 µL

INHBE Rabbit pAb

Sign In for Pricing
View Details