Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-neuregulin-1, membrane-bound isoform protein (NRG1), partial (Active)

Product Specifications

Product Name Alternative

Pro-NRG1, ARIA, Breast cancer cell differentiation factor p45, Glial growth factor, Heregulin

Abbreviation

Recombinant Human NRG1 protein, partial (Active)

Gene Name

NRG1

UniProt

Q02297

Expression Region

177-241aa

Organism

Homo sapiens (Human)

Target Sequence

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQK

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Neuroscience

Relevance

Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The multiple isoforms perform diverse functions such as inducing growth and differentiation of epithelial, glial, neuronal, and skeletal muscle cells; inducing expression of acetylcholine receptor in synaptic vesicles during the formation of the neuromuscular junction; stimulating lobuloalveolar budding and milk production in the mammary gland and inducing differentiation of mammary tumor cells; stimulating Schwann cell proliferation; implication in the development of the myocardium such as trabeculation of the developing heart. Isoform 10 may play a role in motor and sensory neuron development. {ECO:0000269|PubMed:1348215, ECO:0000269|PubMed:7902537}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>97% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 40 ng/ml, corresponding to a specific activity of > 2.5 x 104 IU/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM PB, pH 6.0, 150 mM NaCl

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The multiple isoforms perform diverse functions such as inducing growth and differentiation of epithelial, glial, neuronal, and skeletal muscle cells; inducing expression of acetylcholine receptor in synaptic vesicles during the formation of the neuromuscular junction; stimulating lobuloalveolar budding and milk production in the mammary gland and inducing differentiation of mammary tumor cells; stimulating Schwann cell proliferation; implication in the development of the myocardium such as trabeculation of the developing heart. Isoform 10 may play a role in motor and sensory neuron development. Binds to ERBB4

Molecular Weight

7.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAF6 (NM_004620) Human Over-expression Lysate
LC401463 20 µg

TRAF6 (NM_004620) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR561250 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
CD45RA (Leukocyte Marker) (K4B5), CF405S conjugate, 0.1mg/mL
BNC041680-500 1x 500 µL

CD45RA (Leukocyte Marker) (K4B5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KCNIP4 (NM_001035004) Human Over-expression Lysate
LY422121 100 µg

KCNIP4 (NM_001035004) Human Over-expression Lysate

Sign In for Pricing
View Details
Peripherin (PRPH) Mouse Monoclonal Antibody [Clone ID: OTI8G3]
CF806240 100 µg

Peripherin (PRPH) Mouse Monoclonal Antibody [Clone ID: OTI8G3]

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2810R), Biotin conjugate, 0.1mg/mL
BNCB2810-100 1x 100 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2810R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details