Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Complement Factor D/Adipsin, Rat (P.pastoris, His)

Complement Factor D/Adipsin Protein is pivotal, cleaving factor B within the factor C3b complex to activate the C3bbb complex, serving as the C3 convertase in the alternate pathway—analogous to C1s in the classical pathway. Complement Factor D/Adipsin Protein, Rat (P.pastoris, His) is the recombinant rat-derived Complement Factor D/Adipsin protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Complement Factor D/Adipsin Protein, Rat (P.pastoris, His), Rat, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/complement-factor-d-protein-rat-p-pastoris-his.html

Purity

95.0

Smiles

ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA

Molecular Formula

54249 (Gene_ID) P32038 (I26-A263) (Accession)

Molecular Weight

Approximately 43 kDa. The reducing (R) protein migrat es as 43 kDa in SDS-PAGE may be due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LDOC1 Peptide
DF8771-BP 1 mg

LDOC1 Peptide

Sign In for Pricing
View Details
PPP1R3B Polyclonal Antibody
orb616420-01 50 μL

PPP1R3B Polyclonal Antibody

Sign In for Pricing
View Details
PPP1R3B Polyclonal Antibody
orb616420-02 100 µL

PPP1R3B Polyclonal Antibody

Sign In for Pricing
View Details
ATG7 Rabbit mAb
orb1565253-01 20 ul

ATG7 Rabbit mAb

Sign In for Pricing
View Details
ATG7 Rabbit mAb
orb1565253-02 50 µL

ATG7 Rabbit mAb

Sign In for Pricing
View Details
ATG7 Rabbit mAb
orb1565253-03 100 µL

ATG7 Rabbit mAb

Sign In for Pricing
View Details