Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RN, Horse (His)

IL-1RN protein, an anti-inflammatory antagonist, safeguards against immune dysregulation and systemic inflammation triggered by IL1. It acts on proinflammatory cytokines, including IL1B and IL1A, countering the effects of IL1. Particularly responsive to innate stimulatory agents like pathogens, IL-1RN helps mitigate the inflammatory response, ensuring immune homeostasis. IL-1RN Protein, Horse (His) is the recombinant equine-derived IL-1RN protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RN Protein, Horse (His), Equine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1rn-protein-horse-his.html

Purity

97.80

Smiles

HPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ

Molecular Formula

100034236 (Gene_ID) O18999 (H26-Q177) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRD3 (Bromodomain Containing 3, FLJ23227, FLJ41328, KIAA0043, ORFX, RING3L) (MaxLight 550)
MBS6216054-01 0.1 mL

BRD3 (Bromodomain Containing 3, FLJ23227, FLJ41328, KIAA0043, ORFX, RING3L) (MaxLight 550)

Sign In for Pricing
View Details
BRD3 (Bromodomain Containing 3, FLJ23227, FLJ41328, KIAA0043, ORFX, RING3L) (MaxLight 550)
MBS6216054-02 5x 0.1 mL

BRD3 (Bromodomain Containing 3, FLJ23227, FLJ41328, KIAA0043, ORFX, RING3L) (MaxLight 550)

Sign In for Pricing
View Details
Mouse Polyclonal Phospholipase A2 X Antibody
H00008399-B01P 50 µg

Mouse Polyclonal Phospholipase A2 X Antibody

Sign In for Pricing
View Details
GNL1 (NM_005275) Human Untagged Clone
SC116834 10 µg

GNL1 (NM_005275) Human Untagged Clone

Sign In for Pricing
View Details
Chorionic Gonadotropin, Human, beta (hCGb) (HRP) discontinued
C5069-67E-HRP 100 µL

Chorionic Gonadotropin, Human, beta (hCGb) (HRP) discontinued

Sign In for Pricing
View Details
CROT, NT (CROT, COT, Peroxisomal carnitine O-octanoyltransferase) (FITC) discontinued
034242-FITC 200 µL

CROT, NT (CROT, COT, Peroxisomal carnitine O-octanoyltransferase) (FITC) discontinued

Sign In for Pricing
View Details