Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RN, Horse (His)

IL-1RN protein, an anti-inflammatory antagonist, safeguards against immune dysregulation and systemic inflammation triggered by IL1. It acts on proinflammatory cytokines, including IL1B and IL1A, countering the effects of IL1. Particularly responsive to innate stimulatory agents like pathogens, IL-1RN helps mitigate the inflammatory response, ensuring immune homeostasis. IL-1RN Protein, Horse (His) is the recombinant equine-derived IL-1RN protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RN Protein, Horse (His), Equine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1rn-protein-horse-his.html

Purity

97.80

Smiles

HPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ

Molecular Formula

100034236 (Gene_ID) O18999 (H26-Q177) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDCD1 (NM_001128211) Human Tagged Lenti ORF Clone
RC225950L4 10 µg

NUDCD1 (NM_001128211) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Angiopoietin Like Protein 7 (ANGPTL7) Antibody Pair Kit (with Standard)
MBS2104592-01 5x 96 Tests

Mouse Angiopoietin Like Protein 7 (ANGPTL7) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Angiopoietin Like Protein 7 (ANGPTL7) Antibody Pair Kit (with Standard)
MBS2104592-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Angiopoietin Like Protein 7 (ANGPTL7) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Angiopoietin Like Protein 7 (ANGPTL7) Antibody Pair Kit (with Standard)
MBS2104592-03 10x 96 Tests

Mouse Angiopoietin Like Protein 7 (ANGPTL7) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Angiopoietin Like Protein 7 (ANGPTL7) Antibody Pair Kit (with Standard)
MBS2104592-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse Angiopoietin Like Protein 7 (ANGPTL7) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
DNA Antibody
E55A12026 100 µg

DNA Antibody

Sign In for Pricing
View Details