Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RN, Horse (His)

IL-1RN protein, an anti-inflammatory antagonist, safeguards against immune dysregulation and systemic inflammation triggered by IL1. It acts on proinflammatory cytokines, including IL1B and IL1A, countering the effects of IL1. Particularly responsive to innate stimulatory agents like pathogens, IL-1RN helps mitigate the inflammatory response, ensuring immune homeostasis. IL-1RN Protein, Horse (His) is the recombinant equine-derived IL-1RN protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RN Protein, Horse (His), Equine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1rn-protein-horse-his.html

Purity

97.80

Smiles

HPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ

Molecular Formula

100034236 (Gene_ID) O18999 (H26-Q177) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

H100 5mg
A12335-5 5 mg

H100 5mg

Ask
View Details
TLE1, ID (TLE1, Transducin-like enhancer protein 1, E (Sp1) homolog, Enhancer of split groucho-like protein 1) (FITC) discontinued
031293-FITC 200 µL

TLE1, ID (TLE1, Transducin-like enhancer protein 1, E (Sp1) homolog, Enhancer of split groucho-like protein 1) (FITC) discontinued

Ask
View Details
Mouse Monoclonal FBXO42 Antibody (OTI1H4) [Alexa Fluor 488]
NBP2-71960AF488 0.1 mL

Mouse Monoclonal FBXO42 Antibody (OTI1H4) [Alexa Fluor 488]

Ask
View Details