Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RN, Horse (His)

IL-1RN protein, an anti-inflammatory antagonist, safeguards against immune dysregulation and systemic inflammation triggered by IL1. It acts on proinflammatory cytokines, including IL1B and IL1A, countering the effects of IL1. Particularly responsive to innate stimulatory agents like pathogens, IL-1RN helps mitigate the inflammatory response, ensuring immune homeostasis. IL-1RN Protein, Horse (His) is the recombinant equine-derived IL-1RN protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RN Protein, Horse (His), Equine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1rn-protein-horse-his.html

Purity

97.80

Smiles

HPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ

Molecular Formula

100034236 (Gene_ID) O18999 (H26-Q177) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Acyl-coenzyme A synthetase ACSM4, mitochondrial (ACSM4) ELISA Kit
MBS7253764-01 48 Well

Human Acyl-coenzyme A synthetase ACSM4, mitochondrial (ACSM4) ELISA Kit

Ask
View Details
Human Acyl-coenzyme A synthetase ACSM4, mitochondrial (ACSM4) ELISA Kit
MBS7253764-02 96 Well

Human Acyl-coenzyme A synthetase ACSM4, mitochondrial (ACSM4) ELISA Kit

Ask
View Details
Human Acyl-coenzyme A synthetase ACSM4, mitochondrial (ACSM4) ELISA Kit
MBS7253764-03 5x 96 Well

Human Acyl-coenzyme A synthetase ACSM4, mitochondrial (ACSM4) ELISA Kit

Ask
View Details
Human Acyl-coenzyme A synthetase ACSM4, mitochondrial (ACSM4) ELISA Kit
MBS7253764-04 10x 96 Well

Human Acyl-coenzyme A synthetase ACSM4, mitochondrial (ACSM4) ELISA Kit

Ask
View Details
Mouse Anti-Pig IgG H&L Antibody (AF750)
abx142860-01 100 µL

Mouse Anti-Pig IgG H&L Antibody (AF750)

Ask
View Details
Mouse Anti-Pig IgG H&L Antibody (AF750)
abx142860-02 500 µL

Mouse Anti-Pig IgG H&L Antibody (AF750)

Ask
View Details