Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Replicase 1AB polyprotein, SARS-CoV (Cell-Free, His)

Replicase 1AB polyprotein Protein, SARS-CoV (Cell-Free, His) is the recombinant Virus-derived Replicase 1AB polyprotein protein, expressed by E. coli Cell-free, with N-10*His labeled tag.

Product Specifications

Product Name Alternative

Replicase 1AB polyprotein Protein, SARS-CoV (Cell-Free, His), Virus, E. coli Cell-free

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/replicase-1ab-polyprotein-protein-sars-cov-cf-his.html

Smiles

GKFKKIVKGTHHWMLLTFLTSLLILVQSTQWSLFFFVYENAFLPFTLGIMAIAACAMLLVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDDAARRVWTLMNVITLVYKVYYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITGNTLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKSSIDAFKLNIKLLGIGGKPCIKVATVQ

Molecular Formula

/ (Gene_ID) C8YZ74 (G3547-Q3836) (Accession)

Molecular Weight

35.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF640R conjugate, 0.1mg/mL
BNC400338-500 1x 500 µL

P53 (PAb122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF740 conjugate, 0.1mg/mL
BNC740871-500 1x 500 µL

CD71 (66IG10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C2), CF740 conjugate, 0.1mg/mL
BNC740523-500 1x 500 µL

AFP (Alpha Fetoprotein) (C2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker) (rGPC3/863), CF488A conjugate, 0.1mg/mL
BNC881846-100 1x 100 µL

Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker) (rGPC3/863), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF647 conjugate, 0.1mg/mL
BNC472883-500 1x 500 µL

Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD146 / MCAM / MUC18 / Mucin 18 (C146/634), CF488A conjugate, 0.1mg/mL
BNC880634-500 1x 500 µL

CD146 / MCAM / MUC18 / Mucin 18 (C146/634), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details