IFN-gamma, Porcine
IFN-gamma (interferon-gamma) is a type II interferon produced by immune cells such as T cells and NK cells. It plays a key role in antibacterial, antiviral and anti-tumor responses by activating effector immune cells and enhancing antigen presentation. effect. Its main signaling pathway involves the JAK-STAT pathway that interacts with its receptor IFNGR1, affecting gene regulation. IFN-gamma Protein, Pig is the recombinant Pig-derived IFN-gamma protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
IFN-gamma Protein, Pig, Pig, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ifn-gamma-protein-porcine.html
Purity
95.00
Smiles
SYCQAPFFKEITILKDYFNASTSDVPNGGPLFLEILKNWKEESDKKIIQSQIVSFYFKFFEIFKDNQAIQRSMDVIKQDMFQRFLNGSSGKLNDFEKLIKIPVDNLQIQRKAISELIKVMNDLSPRSNLRKRKRSQTMFQGQRASK
Molecular Formula
396991 (Gene_ID) P17803 (S21-K166) (Accession)
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Human ART3 (Ecto-ADP-ribosyltransferase 3) ELISA Kit
Human ART3 (Ecto-ADP-ribosyltransferase 3) ELISA Kit
GABA Transporter 2 (GAT-2, (Gamma aminobutyrIc acid) (MaxLight 550) discontinued
Recombinant Enterobacter sp. DNA-directed RNA polymerase subunit alpha (rpoA)